Protein Info for BT1368 in Bacteroides thetaiotaomicron VPI-5482

Annotation: UDP-N-acetylenolpyruvoylglucosamine reductase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00179: UDP-N-acetylenolpyruvoylglucosamine reductase
  • amino acids 4 to 330 (327 residues), 218.9 bits, E=4.5e-69
• PF01565: FAD_binding_4
  • amino acids 24 to 143 (120 residues), 63.1 bits, E=2.3e-21
• PF02873: MurB_C
  • amino acids 207 to 329 (123 residues), 98.3 bits, E=2.5e-32

Best Hits

Swiss-Prot: 100% identical to MURB_BACTN: UDP-N-acetylenolpyruvoylglucosamine reductase (murB) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00075, UDP-N-acetylmuramate dehydrogenase [EC: 1.1.1.158] (inferred from 100% identity to bth:BT_1368)

Predicted SEED Role

"UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 1.1.1.158)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)
• peptidoglycan recycling I (8/14 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.158

Sequence Analysis Tools

See Q8A806 at UniProt or InterPro

Protein Sequence (331 amino acids)

>BT1368 UDP-N-acetylenolpyruvoylglucosamine reductase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MYSLLSHNTFGIDVYAERFQEYASVEELKTLIAQGALTTPFLHIGGGSNLLFVKDYEGLV
LHSRIEGIEVTEEDERSVAVRVGAGVVWDDFVGYCVEHGWYGTENLSLIPGEVGASAVQN
IGAYGVEVKDLITSVETVNIHGEERVYAVDECGYAYRDSIFKRPENKSVFVTYVCFRLSK
EERYTLDYGTIRQELEKYPELTLPILRKVIIDIRESKLPDPKVMGNAGSFFMNPIVPREK
LEALQQEFPRIPFYELNDGRVKIPAGWMIDQCGWKGKALGPAAVHDKQALVLVNRGGAKG
SDVLALSDAVRASVRAKFGIDIHPEVNLVGK