Protein Info for BT1339 in Bacteroides thetaiotaomicron VPI-5482

Annotation: undecaprenyl-phosphate alpha-N-acetylglucosaminyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 78 to 105 (28 residues), see Phobius details amino acids 117 to 134 (18 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 174 to 192 (19 residues), see Phobius details amino acids 198 to 216 (19 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details amino acids 313 to 332 (20 residues), see Phobius details amino acids 338 to 357 (20 residues), see Phobius details PF00953: Glycos_transf_4" amino acids 90 to 249 (160 residues), 112.7 bits, see alignment E=9.2e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_1339)

Predicted SEED Role

"Undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.-)" in subsystem Methicillin resistance in Staphylococci or Teichoic and lipoteichoic acids biosynthesis (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A835 at UniProt or InterPro

Protein Sequence (368 amino acids)

>BT1339 undecaprenyl-phosphate alpha-N-acetylglucosaminyltransferase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNILFIIIAFVISVCVARLIIPRILLISFRKKLFDIPDERKVHKRAIPRLGGVSFFPTIL
LSCSVVLALRALTGYGISILFATYILPEFLVLICGMVLLYLTGIADDLVGVRYRQKFMIQ
LICACLFPISGLWINDFYGLFGIYQLSAWFGIPFTILTVIFITNAINLIDGIDGLASGLS
SAALLVLGFLFIDKGLWIYSMLAFSTFGVLVPFFYYNVFGSAEHARKIFMGDTGSLTLGY
ILSFLAIKYSQSTNLIPETQGAIVIAFSTLIVPSFDVIRVVIVRICNGKSPFEPDKNHIH
HQFLAMGFTVRKAMVLILFISCVFSGMNILLMPYVNNTMMLMVDIVVWVGLNLWWSGVRK
KRCHGVGK