Protein Info for BT1321 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative phosphate transport ATP-binding protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 TIGR00972: phosphate ABC transporter, ATP-binding protein" amino acids 6 to 252 (247 residues), 407.3 bits, see alignment E=1e-126 PF00005: ABC_tran" amino acids 21 to 176 (156 residues), 113.6 bits, see alignment E=1.2e-36

Best Hits

Swiss-Prot: 100% identical to PSTB_BACTN: Phosphate import ATP-binding protein PstB (pstB) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K02036, phosphate transport system ATP-binding protein [EC: 3.6.3.27] (inferred from 100% identity to bth:BT_1321)

MetaCyc: 60% identical to phosphate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport ATP-binding protein PstB (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.27 or 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A853 at UniProt or InterPro

Protein Sequence (252 amino acids)

>BT1321 putative phosphate transport ATP-binding protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MDTVKIDTRDVNFWYGDFHALKGISMQIEEKSVVAFIGPSGCGKSTFLRLFNRMNDLIPA
TRLEGEIRIDGHNIYAKGVEVDELRKNVGMVFQRPNPFPKSIFENVAYGLRVNGVKDNAF
IRQRVEETLKGAALWDEVKDKLKESAYALSGGQQQRLCIARAMAVSPSVLLMDEPASALD
PISTAKVEELIHELKKDYTIVIVTHNMQQAARVSDKTAFFYLGEMVEYDDTKKIFTNPEK
EATQNYITGRFG