Protein Info for BT1291 in Bacteroides thetaiotaomicron VPI-5482

Annotation: spermidine/putrescine transport ATP-binding protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 PF03215: Rad17" amino acids 14 to 130 (117 residues), 24 bits, see alignment E=6.8e-09 PF00005: ABC_tran" amino acids 25 to 168 (144 residues), 132 bits, see alignment E=4.9e-42 TIGR01187: polyamine ABC transporter, ATP-binding protein" amino acids 40 to 317 (278 residues), 362.5 bits, see alignment E=9.4e-113 PF08402: TOBE_2" amino acids 278 to 346 (69 residues), 30 bits, see alignment E=9.1e-11 amino acids 396 to 458 (63 residues), 24.9 bits, see alignment E=3.5e-09

Best Hits

Swiss-Prot: 100% identical to POTA_BACTN: Spermidine/putrescine import ATP-binding protein PotA (potA) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K11072, spermidine/putrescine transport system ATP-binding protein [EC: 3.6.3.31] (inferred from 100% identity to bth:BT_1291)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A883 at UniProt or InterPro

Protein Sequence (463 amino acids)

>BT1291 spermidine/putrescine transport ATP-binding protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNMQEDKSIIEVSHVSKFFGDKTALDDVTLNVKKGEFVTILGPSGCGKTTLLRLIAGFQT
ASEGEIRISGKEITQTPPHKRPVNTVFQKYALFPHLNVYDNIAFGLKLKKTPKQTIGKKV
KAALKMVGMTDYEYRDVDSLSGGQQQRVAIARAIVNEPEVLLLDEPLAALDLKMRKDMQM
ELKEMHKSLGITFVYVTHDQEEALTLSDTIVVMSEGKIQQIGTPIDIYNEPINSFVADFI
GESNILNGTMIHDKLVRFCGTEFECVDEGFGENTPVDVVIRPEDLYIFPVSEMAQLTGVV
QTSIFKGVHYEMTVLCGGYEFLVQDYHHFEVGAEVGLLVKPFDIHIMKKERVCNTFEGKL
QDATHVEFLGCTFECASVEGLESGTDVKVEVDFDKVILQDNEEDGTLTGEVKFILYKGDH
YHLTVWSDWDENVFVDTNDVWDDGDRVGITIPPDAIRVIKITD