Protein Info for BT1277 in Bacteroides thetaiotaomicron VPI-5482

Updated annotation (from data): L-fucose/D-arabinose symporter FucP
Rationale: Specifically important for utilizing L-fucose and D-arabinose. The transporter BT0355 also has negative fitness during D-arabinose utilization, but the effect is strand-dependent, which suggests that it is a polar effect. BT1277 is probably the main D-arabinose transporter.
Original annotation: L-fucose permease (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 13 to 33 (21 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 197 to 219 (23 residues), see Phobius details amino acids 252 to 274 (23 residues), see Phobius details amino acids 295 to 316 (22 residues), see Phobius details amino acids 323 to 341 (19 residues), see Phobius details amino acids 347 to 368 (22 residues), see Phobius details amino acids 378 to 399 (22 residues), see Phobius details amino acids 410 to 431 (22 residues), see Phobius details TIGR00885: L-fucose:H+ symporter permease" amino acids 16 to 432 (417 residues), 735 bits, see alignment E=1.4e-225 PF07690: MFS_1" amino acids 26 to 387 (362 residues), 74.6 bits, see alignment E=3.6e-25

Best Hits

KEGG orthology group: K02429, MFS transporter, FHS family, L-fucose permease (inferred from 100% identity to bth:BT_1277)

Predicted SEED Role

"Fucose permease" in subsystem L-fucose utilization or L-fucose utilization temp

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8JZT2 at UniProt or InterPro

Protein Sequence (438 amino acids)

>BT1277 L-fucose/D-arabinose symporter FucP (Bacteroides thetaiotaomicron VPI-5482)
MKHTKQSIISKDGVSYLIPFILITSCFALWGFANDITNPMVKAFSKIFRMSATDGALVQV
AFYGGYFAMAFPAAMFIRKFSYKAGVLLGLGLYAFGAFLFFPAKMTGEYYPFLIAYFILT
CGLSFLETSCNPYILSMGTEETATRRLNLAQSFNPMGSLLGMYVAMQFIQAKLHPMGTDE
RALLNDSEFQAIKESDLAVLIAPYLIIGLVILAMLLLIRFVKMPKNGDQNHKIDFFPTLK
RIFTQTRYREGVIAQFFYVGVQIMCWTFIIQYGTRLFMSPEYGMDEKSAEVLSQQYNIVA
MVIFCISRFICTFILRYLNAGKLLMILAIFGGIFTLGTIFLQNIFGLYCLVAVSACMSLM
FPTIYGIALKGMGDDAKFGAAGLIMAILGGSVLPPLQASIIDMKEIASMPAVNVSFILPL
TCFLVIIGYGYRTVKRNW