Protein Info for BT1276 in Bacteroides thetaiotaomicron VPI-5482

Updated annotation (from data): L-fucose mutarotase FucU (EC 5.1.3.29)
Rationale: Specifically important for utilization of L-fucose and D-arabinose. The phenotype on D-arabinose is strand-dependent and may be a polar effect on the downstream permease.
Original annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05336: rhaM
  • amino acids 19 to 127 (109 residues), 110.3 bits, E=2.7e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_1276)

Predicted SEED Role

"L-fucose mutarotase, type 2"

MetaCyc Pathways

• superpathway of fucose and rhamnose degradation (10/12 steps found)
• L-fucose degradation I (4/4 steps found)
• L-fucose degradation II (1/5 steps found)
• L-fucose degradation III (2/8 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.29

Sequence Analysis Tools

See Q8A896 at UniProt or InterPro

Protein Sequence (130 amino acids)

>BT1276 L-fucose mutarotase FucU (EC 5.1.3.29) (Bacteroides thetaiotaomicron VPI-5482)
METPQTGYQVKTYNVPVKRYCQTLDLRDSPELIAEYRKRHSQAEVWPEILAGIREVGILE
MEIYILGTRLFMIVETPVDFDWDTAMARLNTLPRQQEWEEYMSILQQAAPGMSSAEKWIP
MERMFHLYNT