Protein Info for BT1274 in Bacteroides thetaiotaomicron VPI-5482

Updated annotation (from data): L-fuculose-1-phosphate aldolase FucA (4.1.2.17); D-ribulose-1-phosphate aldolase
Rationale: Specifically important for utilizing L-fucose and D-arabinose, which are catabolized via L-fucolose-1-phosphate or D-ribulose-1-phosphate.
Original annotation: L-fuculose-1-phosphate aldolase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00596: Aldolase_II
  • amino acids 15 to 184 (170 residues), 131.6 bits, E=1.6e-42

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_1274)

Predicted SEED Role

"L-fuculose phosphate aldolase (EC 4.1.2.17)" in subsystem L-fucose utilization (EC 4.1.2.17)

MetaCyc Pathways

• superpathway of fucose and rhamnose degradation (10/12 steps found)
• L-fucose degradation I (4/4 steps found)
• D-arabinose degradation II (3/4 steps found)
• nucleoside and nucleotide degradation (halobacteria) (3/6 steps found)
• lactate biosynthesis (archaea) (2/5 steps found)
• superpathway of pentose and pentitol degradation (12/42 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.17

Sequence Analysis Tools

See G8JZT1 at UniProt or InterPro

Protein Sequence (212 amino acids)

>BT1274 L-fuculose-1-phosphate aldolase FucA (4.1.2.17); D-ribulose-1-phosphate aldolase (Bacteroides thetaiotaomicron VPI-5482)
MITDEHIELFLAQAHRYGDAKLMLCSSGNLSWRIGEEALISGTGSWVPTLAKEKVSICNI
ASGTPTNGVKPSMESTFHLGVLRERPDVNVVLHFQSEYATAISCMKNKPTNFNVTAEIPC
HVGSEIPVIPYYRPGSPELAKAVVEAMLKHNSVLLTNHGQVVCGKDFDQVYERATFFEMA
CRIIVQSGGDYSVLTPEEIEDLEIYVLGKKTK