Protein Info for BT1270 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative Na+/H+ antiporter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 40 to 57 (18 residues), see Phobius details amino acids 78 to 95 (18 residues), see Phobius details amino acids 116 to 143 (28 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 200 to 223 (24 residues), see Phobius details amino acids 235 to 265 (31 residues), see Phobius details amino acids 277 to 299 (23 residues), see Phobius details amino acids 373 to 398 (26 residues), see Phobius details amino acids 410 to 428 (19 residues), see Phobius details PF03553: Na_H_antiporter" amino acids 76 to 213 (138 residues), 46 bits, see alignment E=2.3e-16 amino acids 240 to 428 (189 residues), 55.8 bits, see alignment E=2.3e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_1270)

Predicted SEED Role

"Methionine transporter MetT" in subsystem Methionine Biosynthesis or Methionine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A897 at UniProt or InterPro

Protein Sequence (433 amino acids)

>BT1270 putative Na+/H+ antiporter (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MTEEKIHIERHGSWWALSPLLVFLCLYLVTSILVNDFYKVPITVAFLVSSCYAIAITRGL
KLDQRIYQFSVGAANKNILLMIWIFILAGAFAQSAKQMGAIDATVNLTLHILPDNLLLAG
IFIAACFISLSIGTSVGTIVALTPVAVGLAEKTEIALPFMVAVVVGGSFFGDNLSFISDT
TIASTKTQECVMRDKFRVNSMIVVPAAIIVLGIYIFQGLSITAPAQVQTIEWIKVIPYII
VLGTAIAGMNVMLVLIIGILTSGIIGIATGSFDVFDWFGAMGTGITGMGELIIITLLAGG
MLETIRYNGGIDFIIKKLTRHVNSKRGAELSIAALVSIANLCTANNTIAIITTGPIAKDI
AKRFHLDRRKTASILDTFSCLIQGIIPYGAQMLIAAGLANISPISIIGNLYYPFTMGVCA
LLAILFRYPRRYS