Protein Info for BT1243 in Bacteroides thetaiotaomicron VPI-5482

Annotation: GrpE protein (Hsp-70 cofactor) (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 PF01025: GrpE" amino acids 30 to 192 (163 residues), 160.2 bits, see alignment E=1.9e-51

Best Hits

Swiss-Prot: 100% identical to GRPE_BACTN: Protein GrpE (grpE) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K03687, molecular chaperone GrpE (inferred from 100% identity to bth:BT_1243)

Predicted SEED Role

"Heat shock protein GrpE" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A8C4 at UniProt or InterPro

Protein Sequence (193 amino acids)

>BT1243 GrpE protein (Hsp-70 cofactor) (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MDPKEKEKMAEELNVEETKDTAEEQPQDDQAEEAAPLTHEEQLEKELEDAQAVIEEQKDK
YLRLSAEFDNYRKRTMKEKAELILNGGEKSISSILPVIDDFERAIKTMETAKDVKAVKEG
VELIYNKFMAVMAQNGVKVIETKDQPLDTDYHEAIAVIPAPSEEQKGKILDCVQTGYTLN
DKVIRHAKVVVGE