Protein Info for BT1219 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 TIGR01413: Dyp-type peroxidase family" amino acids 16 to 309 (294 residues), 259.7 bits, see alignment E=2.1e-81 PF04261: Dyp_perox_N" amino acids 18 to 145 (128 residues), 85.5 bits, see alignment E=3.8e-28 PF20628: Dyp_perox_C" amino acids 150 to 308 (159 residues), 181.3 bits, see alignment E=1.3e-57

Best Hits

KEGG orthology group: K07223, putative iron-dependent peroxidase (inferred from 100% identity to bth:BT_1219)

Predicted SEED Role

"Predicted dye-decolorizing peroxidase (DyP), encapsulated subgroup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A8E8 at UniProt or InterPro

Protein Sequence (316 amino acids)

>BT1219 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNPFQNSFGGHIPQDVAGKQGENVIFIVYNLTDSPDTVDKVKDVCANFSAMIRSMRNRFP
DMQFSCTMGFGADAWTRLFPDKGKPKELSTFSEIKGEKYTAVSTPGDLLFHIRAKQMGLC
FEFASILDEKLKGAVVSVDETHGFRYMDGKAIIGFVDGTENPAVDENPYHFAVIGEEDAD
FAGGSYVFVQKYIHDMVAWNALPVEQQEKVIGRHKFNDVELSDEEKPGNAHNAVTNIGDD
LKIVRANMPFANTSKGEYGTYFIGYASTFSTTRRMLENMFIGSPAGNTDRLLDFSTAITG
TLFFVPSYDLLGELGE