Protein Info for BT1082 in Bacteroides thetaiotaomicron VPI-5482

Annotation: Na+/solute symporter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 50 (21 residues), see Phobius details amino acids 72 to 98 (27 residues), see Phobius details amino acids 104 to 121 (18 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details amino acids 186 to 203 (18 residues), see Phobius details amino acids 224 to 250 (27 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details amino acids 327 to 346 (20 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details amino acids 382 to 401 (20 residues), see Phobius details amino acids 413 to 429 (17 residues), see Phobius details PF00474: SSF" amino acids 3 to 379 (377 residues), 48 bits, see alignment E=4.5e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_1082)

Predicted SEED Role

"sodium/iodide co-transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A8T5 at UniProt or InterPro

Protein Sequence (438 amino acids)

>BT1082 Na+/solute symporter (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MIGATISGVTFVSVPGMVRGMDMTYMQTVFGFFFGYMIVAHILLPLYYRLNLTSIYGYLG
TRIGVNAYRTGSFFFLLSRMLGTAAKLYLVCLILHTHVFQDMHIPFWVIAVGSVALVWIY
THKSGIKTIVWTDTLQTFCLIAALLFIIYFTIQKLDVGFDGIVQTIRHSEHSRIFVFDDW
MSRQNFFKQFFSGIFIVIVMTGLDQDMMQKNLSCRNLHEAKKNMYCYGFSFIPLNFLFLC
LGILLIALAGQMQLELPAMNDDILPMFATQGYLGQSVLILFTIGIIAAAFSNSDSALTAM
TTSVCIDLLNTDKDTEETARRKRKKVHLSLSILLAFFICLVEMLNNKSVIDAIYIIASYT
YGPLLGMFAFGLFTRRRTKDRLVPLIAIASPVLCYALDWWINKETGYKFGYELLMLNGSL
TFAGLMLLSGKEKTVETP