Protein Info for BT1075 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative two-component system sensor protein, but no histidine kinase domain (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 80 to 105 (26 residues), see Phobius details amino acids 119 to 142 (24 residues), see Phobius details PF06580: His_kinase" amino acids 162 to 240 (79 residues), 81.6 bits, see alignment E=2e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_1075)

Predicted SEED Role

"putative two-component system sensor protein histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A8U2 at UniProt or InterPro

Protein Sequence (345 amino acids)

>BT1075 putative two-component system sensor protein, but no histidine kinase domain (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MRQKFNYLFIGLLFSGLAFFSYLFLLLYSDFTPQHLEVLISFKSFILILAAFNLVGFGVL
MIHNWQKRSFQFLVKRKERLIIDCILTAIILFLMNYLVLSIVKAIFEVPAPFTLKGSGLR
MIALVWLVEMVITNLTLTINFYRQLVLLHERTEQVEENSIKAQYAALQNQLNPHFLFNSL
NTLISEIEYAPKNAILFTQRLSDVYRYILQSQQQRLVTIESELSFIDSYIFLHKVRLGDC
IRIENRIEADNYDLKLPSLTLQLLVENVIKHNIINMDMPMNILIDYDSENGRILVTNKIR
IKPNVVSTGMGLKNLSARYLLICNQDITIENNTNYFTVKIPVLNE