Protein Info for BT0913 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative Fe-S oxidoreductase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 5 to 429 (425 residues), 394.5 bits, see alignment E=5.8e-122 TIGR01125: ribosomal protein S12 methylthiotransferase RimO" amino acids 5 to 428 (424 residues), 472.9 bits, see alignment E=1.1e-145 PF00919: UPF0004" amino acids 6 to 106 (101 residues), 80.5 bits, see alignment E=1.2e-26 PF04055: Radical_SAM" amino acids 141 to 312 (172 residues), 88.3 bits, see alignment E=1e-28 PF18693: TRAM_2" amino acids 369 to 431 (63 residues), 74.3 bits, see alignment E=1e-24

Best Hits

Swiss-Prot: 100% identical to RIMO_BACTN: Ribosomal protein S12 methylthiotransferase RimO (rimO) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K14441, ribosomal protein S12 methylthiotransferase [EC: 2.-.-.-] (inferred from 100% identity to bth:BT_0913)

Predicted SEED Role

"Ribosomal protein S12p Asp88 (E. coli) methylthiotransferase" in subsystem Ribosomal protein S12p Asp methylthiotransferase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A9A2 at UniProt or InterPro

Protein Sequence (436 amino acids)

>BT0913 putative Fe-S oxidoreductase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKRKRIDIITLGCSKNLVDSEQLMRQLEEAGYSVTHDTENPEGEIAVINTCGFIGDAKEE
SINMILEFAERKEEGDLKKLFVMGCLSERYLQELAIEIPQVDKFYGKFNWKELLQDLGKT
YHEELYIERTLTTPKHYAYLKISEGCDRKCSYCAIPIITGRHISKSMEEILDEVRYLVSQ
GVKEFQVIAQELTYYGVDLYKKQMLPELIERISEIPGVEWIRLHYAYPAHFPTDLFRVMR
ERDNVCKYMDIALQHISDNMLKLMRRQVSKEDTYKLIEQFRKEVPGIHLRTTLMVGHPGE
TEEDFEELKEFVRKARFDRMGAFAYSEEEGTYAAQQYEDSIPQEVKQARLDELMDIQQGI
SAELSAAKIGQQMKVIIDRIEGDYYIGRTEFDSPEVDPEVLISVSREELEVGQFYQVEVT
DADDFDLYAKILNKYE