Protein Info for BT0907 in Bacteroides thetaiotaomicron VPI-5482

Annotation: BatA (Bacteroides aerotolerance operon) (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 301 to 318 (18 residues), see Phobius details PF07584: BatA" amino acids 1 to 74 (74 residues), 53.2 bits, see alignment E=5.1e-18 PF00092: VWA" amino acids 89 to 279 (191 residues), 82.4 bits, see alignment E=7e-27 PF13519: VWA_2" amino acids 90 to 196 (107 residues), 71.6 bits, see alignment E=1.2e-23

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 100% identity to bth:BT_0907)

Predicted SEED Role

"BatA (Bacteroides aerotolerance operon)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A9A8 at UniProt or InterPro

Protein Sequence (327 amino acids)

>BT0907 BatA (Bacteroides aerotolerance operon) (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MFFANIEYLFLLLLLIPYIVWYILKRKKTEATLQISDARVYAHTPKSYKNYLLHAPFILR
VIALALIIVVLARPQSTNKWQNSEIEGIDIMLAIDVSTSMLAEDLKPNRLEAAKDVAAEF
INGRPNDNIGITLFAGETFTQCPLTVDHAVLLDMIHNIKCGLIEDGTAVGMGVANAVTRL
KDSKAKSKVIILLTDGTNNKGDISPLTAAEIAKSFGIRVYTIGVGTNGMAPYPYPVGNTV
QYINMPVEIDEKTLTQIAGTTDGNYFRATSNSKLKEVYEEIDKLEKTKLNVKEYSKREED
YRWFALAAFLCVLLEVLLRNSILKKIP