Protein Info for BT0897 in Bacteroides thetaiotaomicron VPI-5482

Annotation: chaperone protein htpG (heat shock protein htpG) (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 681 PF13589: HATPase_c_3" amino acids 27 to 146 (120 residues), 36 bits, see alignment E=1.1e-12 PF00183: HSP90" amino acids 210 to 580 (371 residues), 178.2 bits, see alignment E=5e-56

Best Hits

Swiss-Prot: 100% identical to HTPG_BACTN: Chaperone protein HtpG (htpG) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K04079, molecular chaperone HtpG (inferred from 100% identity to bth:BT_0897)

Predicted SEED Role

"Chaperone protein HtpG" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A9B8 at UniProt or InterPro

Protein Sequence (681 amino acids)

>BT0897 chaperone protein htpG (heat shock protein htpG) (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MQKGNIGVTTENIFPIIKKFLYSDHEIFLRELVSNAVDATQKLNTLASIGEFKGELGDLT
IHVELGKDTITISDRGIGLTAEEIEKYINQIAFSGANDFLEKYKDDANAIIGHFGLGFYS
AFMVAKKVEIITKSYRDEAQAIKWTCDGSPEFTIEEVDKADRGSDIILYIDDDCKEFLEE
ARVSELLKKYCSFLPVPIAFGKKKEWKDGKQIETTEDNIINDTTPLWTRKPSELSDEDYK
SFYTKLYPMSDEPLFWIHLNVDYPFHLTGILYFPKVKSNIELNKNKIQLYCNQVYVTDSV
EGIVPDFLTLLHGVIDSPDIPLNVSRSYLQSDSNVKKISTYITKKVSDRLQSIFKNDRKQ
FEEKWNDLKIFINYGMLTQEDFYEKAQKFALFTDTDNKHYTFEEYQTLIKDNQTDKDGNL
IYLYANNKDEQFSYIEAATNKGYNVLLMDGQLDVAMVSMLEQKFEKSRFTRVDSDVIDNL
IIKEDKKNETLEGEKQEAITTAFKSQLPKMDKVEFNVMTQALGDNSAPVMITQSEYMRRM
KEMANIQAGMSFYGEMPDMFNLVLNSDHKLIKQVLDEEEAACHPEVAPIQTEMNSVSKRR
NELKDSQKDKKEEDIPTAEKDELNELDKKWDELKNKKEGIFAGYASNNKVIRQLIDLALL
QNNMLKGEALNNFVKRSIELI