Protein Info for BT0832 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative phosphoserine phosphatase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 PF13740: ACT_6" amino acids 7 to 81 (75 residues), 95.8 bits, see alignment E=3.5e-31 PF21086: ACT_PSP_2" amino acids 103 to 185 (83 residues), 27.8 bits, see alignment E=6.5e-10 TIGR00338: phosphoserine phosphatase SerB" amino acids 185 to 399 (215 residues), 261.7 bits, see alignment E=5.1e-82 PF00702: Hydrolase" amino acids 196 to 369 (174 residues), 76.1 bits, see alignment E=1.5e-24 TIGR01488: HAD phosphoserine phosphatase-like hydrolase, family IB" amino acids 197 to 365 (169 residues), 120.5 bits, see alignment E=7.5e-39 PF12710: HAD" amino acids 199 to 365 (167 residues), 79.3 bits, see alignment E=1.6e-25 PF08282: Hydrolase_3" amino acids 331 to 400 (70 residues), 39.7 bits, see alignment E=1.5e-13

Best Hits

KEGG orthology group: K01079, phosphoserine phosphatase [EC: 3.1.3.3] (inferred from 100% identity to bth:BT_0832)

Predicted SEED Role

"Phosphoserine phosphatase (EC 3.1.3.3)" in subsystem Glycine and Serine Utilization or Serine Biosynthesis (EC 3.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A9I3 at UniProt or InterPro

Protein Sequence (409 amino acids)

>BT0832 putative phosphoserine phosphatase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MQPSNTELILIRVTGEDRPGLTASVTEILAKYDATILDIGQADIHNTLSLGILFRSEERH
SGFIMKELLFKASSLGVTIRFEPIGTDQYENWVGMQGKNRYILTVLGRKLSARQISAATR
VLAEQDLNIDAIKRLTGRIPLDEDKTDTRTRACIEFSVRGTPKDRIAMQERLMQLASEQE
MDFSFQQDNMYRRMRRLICFDMDSTLIETEVIDELAIRAGVGDEVKAITESAMRGEIDFT
ESFTRRVALLKGLDESVMQEIAESLPITEGVDRLMYVLKKYGYKIAILSGGFTYFGQYLQ
KKYGIDYVYANELEIVDGKLTGRYLGDVVDGKRKAELLRLIAQVEKVDIAQTIAVGDGAN
DLPMLGIAGLGIAFHAKPKVVANAKQSINTIGLDGVLYFLGFKDSYLNM