Protein Info for BT0821 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative permease (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 84 to 107 (24 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 165 to 183 (19 residues), see Phobius details amino acids 195 to 217 (23 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details amino acids 282 to 302 (21 residues), see Phobius details amino acids 313 to 332 (20 residues), see Phobius details amino acids 340 to 360 (21 residues), see Phobius details amino acids 380 to 403 (24 residues), see Phobius details amino acids 429 to 449 (21 residues), see Phobius details PF07690: MFS_1" amino acids 25 to 327 (303 residues), 66.9 bits, see alignment E=1.6e-22 PF00854: PTR2" amino acids 243 to 402 (160 residues), 35.7 bits, see alignment E=4.8e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_0821)

Predicted SEED Role

"Di-/tripeptide transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A9J4 at UniProt or InterPro

Protein Sequence (462 amino acids)

>BT0821 putative permease (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNNSPQRAAKGFTRAFWVSNTVELFERMAYYAVFIVLTIYLSSILGFNDFEASMISGLFS
GGLYLLPIFSGAYADKIGFRKSMIIAFSLLSIGYLGLGVFPTLLEAAGLVSYGATTRFNG
LPDSSSRWIIVPILFILMIGGSFIKSIISASVAKETTEATRARGYSIFYMMVNVGAFTGK
TIIDPLRNVIGEQAYIYINYFSGAMTVIALLAVILLYKSTHTAGEGKSLREIGQGFMRIM
TNWRLLILILIVTGFWMVQQQLYATMPKYVIRLAGETAKPGWIANVNPFVVVCCVSFITR
LMAKRSAITSMNVGMFLIPVSALLMACGNILGNDIISGMSNITLMMVAGIVVQALAECFI
SPRYLEYFSLQAPKGEEGMYLGFSHLHSFLSSIFGFGLAGILLTKYCPDPALFETRAAWE
AASANAHYIWYYFAAIGLIAAIALLLFAKITESIDKKKKSSR