Protein Info for BT0802 in Bacteroides thetaiotaomicron VPI-5482

Annotation: arsenical pump-driving ATPase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 570 TIGR04291: arsenical pump-driving ATPase" amino acids 11 to 568 (558 residues), 815.8 bits, see alignment E=2.2e-249 PF02374: ArsA_ATPase" amino acids 12 to 291 (280 residues), 201.8 bits, see alignment E=1e-62 amino acids 328 to 470 (143 residues), 96.7 bits, see alignment E=1e-30 amino acids 484 to 556 (73 residues), 31.3 bits, see alignment E=8.1e-11 TIGR00345: transport-energizing ATPase, TRC40/GET3/ArsA family" amino acids 16 to 294 (279 residues), 250 bits, see alignment E=3.6e-78 PF13614: AAA_31" amino acids 17 to 167 (151 residues), 42.7 bits, see alignment E=4.2e-14 amino acids 327 to 453 (127 residues), 36.5 bits, see alignment E=3.1e-12 PF01656: CbiA" amino acids 17 to 244 (228 residues), 35 bits, see alignment E=8.1e-12 amino acids 330 to 411 (82 residues), 26.1 bits, see alignment E=4.9e-09

Best Hits

KEGG orthology group: K01551, arsenite-transporting ATPase [EC: 3.6.3.16] (inferred from 100% identity to bth:BT_0802)

Predicted SEED Role

"Arsenical pump-driving ATPase (EC 3.6.3.16)" in subsystem Arsenic resistance (EC 3.6.3.16)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.16

Use Curated BLAST to search for 3.6.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A9L3 at UniProt or InterPro

Protein Sequence (570 amino acids)

>BT0802 arsenical pump-driving ATPase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKAFNLSDIELTKYLFFTGKGGVGKTSIACATAVGLADKGKKILLISTDPASNLQDVFDQ
SLNGHGTAISEVPGLTVVNLDPEQAAAEYRESVIAPFRGKLPESVIQNMEEQLSGSCTVE
IAAFNEFSDFITDADKAKEYDHIIFDTAPTGHTLRMLQLPSAWSTFISESTHGASCLGQL
SGLEERKGIYKQAVETLSNTSATRLVLVSRPEISPLKEAARSSSELQLLGIKNQLLVING
ILQQLNEADDVSRQLHNRQQKALQGMPAELSEYPMYSVPLRSYNLSDIANIRRMLYSDSL
ADDICYQPVSGAKSIDDLVNDLYTSGKRVVFTMGKGGVGKTTLATEIALKLTKLGAKVHL
TTTDPANHLNYDLAIKSGITVSHIDEAEVLENYKNEVRSKAAETMTAEDMEYIEEDLRSP
CTQEIAVFKAFAEIVDKADNEIVVIDTAPTGHTLLLLDATQSYHKEVERTQGAVTGAVAN
LLPRLRNPKETEVVIVTLPEATPVFEAERLQMDLQRAGINNKWWVVNACLSMTNTENSFL
QAKAQNEVNWIKKVEQLSKGNAALIGWKNI