Protein Info for BT0722 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein, putative surface protein, function unknown (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 20 to 21 (2 residues), see Phobius details amino acids 31 to 52 (22 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 154 to 170 (17 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details PF03956: Lys_export" amino acids 8 to 204 (197 residues), 230.1 bits, see alignment E=8.2e-73

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_0722)

Predicted SEED Role

"putative surface protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A9U3 at UniProt or InterPro

Protein Sequence (206 amino acids)

>BT0722 conserved hypothetical protein, putative surface protein, function unknown (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKGSLIVIVFFCVGCIMGVFNKFQFDTHTVSMYILYALMLQVGISIGSNKNLKAIISHLH
PKMLLIPLGTITGTLLFSALASILLSQWSVFDCMAVGSGFAYYSLSSILITQFKEPTIGI
QLATELGTIALLTNIFREMMALLGTPLIKKYFGKLAPISAAGVNSMDVLLPSISRYSGKE
MIPIAILHGILIDISVPVFVSFFCNL