Protein Info for BT0695 in Bacteroides thetaiotaomicron VPI-5482

Annotation: ABC transporter, permease protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 771 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 280 to 305 (26 residues), see Phobius details amino acids 326 to 352 (27 residues), see Phobius details amino acids 373 to 396 (24 residues), see Phobius details amino acids 417 to 439 (23 residues), see Phobius details amino acids 649 to 668 (20 residues), see Phobius details amino acids 700 to 719 (20 residues), see Phobius details amino acids 734 to 757 (24 residues), see Phobius details PF12704: MacB_PCD" amino acids 81 to 244 (164 residues), 43.7 bits, see alignment E=4e-15 PF02687: FtsX" amino acids 285 to 399 (115 residues), 43.2 bits, see alignment E=3.7e-15 amino acids 651 to 764 (114 residues), 58.8 bits, see alignment E=5.4e-20

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 100% identity to bth:BT_0695)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A9X0 at UniProt or InterPro

Protein Sequence (771 amino acids)

>BT0695 ABC transporter, permease protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MRQIYYSIRTLLRERGTNIIRVISLSLGLTIGILLFSQIAFELSYERCYPEPERLAIARC
LTTNLSTGETMGDDGNNYDYTLFDVVASTLAQDMPEEIEFASCVLTGQGMSIYYEDKLLS
DVNYIYADTCFFQTFGIPVLKGNPKDMIMPGSVFVSEHFARETFGDADPIGKILKADRQN
DFTIRGVYKDMPENTVLTHDFVVSIHRDGGYQGGYGWKGNDVFYTFLRLRNAADIDKVND
NIQRVIEKYTPAQYDDWKMNFSVIPLVKYHLISSDVQKRLIIYGFLGFAIFFVAIMNYML
ISIATLSRRAKGVGVHKCSGASSGNIFGMFLAETGILVIFSVLLSLLLIVNAHEIIEDLL
SVRLSSLFAWETLWVPLLTIVILFLLAGGIPGRLFSRIPVTQVFRRYSDGKTGWKRSLLF
IQFTGVSFVLGLLLVTLLQYNHLMSRDMGINVPGLVQAGTWLPKETVEHVTDELRRQPMV
EGVAVATSGVIGQYWTRGLMSNDGKRIATLNFNYCSYNYPEVMGIKIIEGSTLKKQDDLL
VNEELVRLMKWTDGAVGKKLNDIQGTIVGVFRDVRNYSFFSTQAPIVLIGSENTNHVFDV
RLKEPYDENLKRLNEFADKTFPNVALHFSSVDGMIKDIYKSVYRFRNSVWITSSFILLIV
IMGLIGYVNDETQRRSKEIAIRKVNGAEASHILRLLIREILYVSASSILIGTIVSYFVGK
AWLDQFAEQIYMNPLLFVGTALFVLLLIVVCVVLKAWHIANENPVKSIKSE