Protein Info for BT0643 in Bacteroides thetaiotaomicron VPI-5482

Annotation: RNA methyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00479: 23S rRNA (uracil-5-)-methyltransferase RumA
  • amino acids 3 to 446 (444 residues), 349.6 bits, E=1.2e-108
• PF01938: TRAM
  • amino acids 4 to 44 (41 residues), 24.1 bits, 5.3e-09
• PF05958: tRNA_U5-meth_tr
  • amino acids 276 to 452 (177 residues), 71.6 bits, E=1.3e-23
• PF09445: Methyltransf_15
  • amino acids 310 to 391 (82 residues), 23.4 bits, E=8.1e-09
• PF13847: Methyltransf_31
  • amino acids 311 to 385 (75 residues), 35.8 bits, E=1.4e-12

Best Hits

Swiss-Prot: 100% identical to Y643_BACTN: Uncharacterized RNA methyltransferase BT_0643 (BT_0643) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00599, [EC: 2.1.1.-] (inferred from 100% identity to bth:BT_0643)

Predicted SEED Role

"RNA methyltransferase, TrmA family"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See Q8AA22 at UniProt or InterPro

Protein Sequence (454 amino acids)

>BT0643 RNA methyltransferase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MAAEGKAIAKVNDLVIFVPYVVPGDVVDLQIKRKKNKYAEAEAVKFHELSPVRAVPFCQH
YGVCGGCKWQVLPYSEQIRYKQKQVEDNLRRIGKIELPEISPILGSAKTEFYRNKLEFTF
SNKRWLTNDEVRQDVKYDQMNAVGFHIPGAFDKVLAIEKCWLQDDISNRIRNAVRDYAYE
HDYSFINLRTQEGMLRNLIIRTSSTGELMVIVICKITEDHEMELFKQLLQFIADSFPEIT
SLLYIINNKCNDTINDLDVHVFKGKDHMFEEMEGLRFKVGPKSFYQTNSEQAYNLYKIAR
EFAGLTGKELVYDLYTGTGTIANFVSRQARQVIGIEYVPEAIEDAKVNAEINEIKNALFY
AGDMKDMLTQEFINQHGRPDVIITDPPRAGMHQDVVDVILFAEPKRIVYVSCNPATQARD
LQLLDGKYKVKAVQPVDMFPHTHHVENVVLLELR