Protein Info for BT0638 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative methionine aminopeptidase A (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 TIGR00500: methionine aminopeptidase, type I" amino acids 62 to 306 (245 residues), 297.6 bits, see alignment E=3.7e-93 PF00557: Peptidase_M24" amino acids 69 to 299 (231 residues), 184.4 bits, see alignment E=1.2e-58

Best Hits

Swiss-Prot: 46% identical to MAP12_SYNY3: Methionine aminopeptidase B (slr0786) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K01265, methionyl aminopeptidase [EC: 3.4.11.18] (inferred from 100% identity to bth:BT_0638)

Predicted SEED Role

"Methionine aminopeptidase (EC 3.4.11.18)" (EC 3.4.11.18)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.18

Use Curated BLAST to search for 3.4.11.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AA27 at UniProt or InterPro

Protein Sequence (307 amino acids)

>BT0638 putative methionine aminopeptidase A (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MINDFIFHLFSYLCSTIKKHPIIMKNFIKGFRFTPSNYPAEVEAKIQKYRKQGYKLPPRK
VLRTPEQLEGIRESAKINTALLDYISENIREGMSTEEIDVMVYDFTTKHGAIPAPLNYEG
FPKSVCTSINDVVCHGIPSKTEILQSGDIINVDVSTIYKGYFSDASRMFMIGDVSPEMRK
LVQVTKECMEIGIAAAQPWKQLGDVGAAIQEHAEKNGFNVVRDLCGHGVGMQFHEAPDVE
HFGRRGTGMMIVPGMTFTIEPMINMGTYEVFVDEADGWTVCTDDGLPSAQWENMILITET
GNEILTY