Protein Info for BT0627 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein, with a conserved domain of unknown function (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 TIGR01033: DNA-binding regulatory protein, YebC/PmpR family" amino acids 2 to 239 (238 residues), 247.1 bits, see alignment E=1.1e-77 PF20772: TACO1_YebC_N" amino acids 4 to 74 (71 residues), 87.6 bits, see alignment E=6.1e-29 PF01709: Transcrip_reg" amino acids 79 to 238 (160 residues), 170.9 bits, see alignment E=1.9e-54

Best Hits

Swiss-Prot: 100% identical to Y627_BACTN: Probable transcriptional regulatory protein BT_0627 (BT_0627) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: None (inferred from 100% identity to bth:BT_0627)

Predicted SEED Role

"FIG000859: hypothetical protein YebC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AA38 at UniProt or InterPro

Protein Sequence (247 amino acids)

>BT0627 conserved hypothetical protein, with a conserved domain of unknown function (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MGRAFEYRKAAKLKRWGHMAKTFTRLGKQIAIAVKAGGPEPENNPTLRSVIATCKRENMP
KDNIERAIKNAMGKDQSDYKSMTYEGYGPHGIAVFVDTLTDNTTRTVADVRSVFNKFGGN
LGTMGSLAFLFDHKCMFTFKIKDGMDMEELILDLIDYDVEDEYEQDDEEGTITIYGDPKS
YAAIQKHLEECGFEDVGGDFTYIPNDLKEVTPEQRETLDKMIERLEEFDDVQTVYTNMKP
EEGGNEE