Protein Info for BT0625 in Bacteroides thetaiotaomicron VPI-5482

Annotation: DNA helicase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 PF00772: DnaB" amino acids 26 to 126 (101 residues), 112.5 bits, see alignment E=1.4e-36 TIGR00665: replicative DNA helicase" amino acids 26 to 465 (440 residues), 542.9 bits, see alignment E=2.8e-167 PF03796: DnaB_C" amino acids 201 to 464 (264 residues), 353 bits, see alignment E=1.5e-109 PF13481: AAA_25" amino acids 201 to 378 (178 residues), 27.1 bits, see alignment E=4.6e-10

Best Hits

KEGG orthology group: K02314, replicative DNA helicase [EC: 3.6.4.12] (inferred from 100% identity to bth:BT_0625)

Predicted SEED Role

"Replicative DNA helicase (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AA40 at UniProt or InterPro

Protein Sequence (517 amino acids)

>BT0625 DNA helicase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MAEQRRNSRNTKSTKVQPVNDYGRIQPQAPELEEAVLGALMIEKDAYSLVSEILRPESFY
EHRHQLIYAAITDLAVNQKPVDILTVKEQLSKRGELEEVGGPFYITQLSSKVASSAHIEY
HARIIAQKSLARELITFTSNIQSKAFDETLDVDDLMQEAEGKLFEISQQNMKKDYTQINP
VIDEAYKLIQKAAARTDGLSGLESGFTKLDKMTSGWQNSDLIIIAARPAMGKTAFVLSMA
KNIAVDYRNPVALFSLEMSNVQLVNRLITNVCEIPSEKIKSGQLASYEWQQLDYKLKDLL
DAPLYVDDTPSLSVFELRTKARRLVREHGVRIIIIDYLQLMNASGMAFGSRQEEVSTISR
SLKGLAKELNIPIIALSQLNRGVESREGIDGKRPQLSDLRESGAIEQDADMVCFIHRPEY
YKIYQDDRGNDLRGMAEIVIAKHRNGAVGEVLLRFKGEFTRFSNPEDDMVIPMPGEPAGA
MLGSKLNAGAMPPPPPEPDFVPQGNNPFGATEGPLPF