Protein Info for BT0621 in Bacteroides thetaiotaomicron VPI-5482

Annotation: Na+-transporting NADH:ubiquinone oxidoreductase, Electron transport complex protein rnfE (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 43 to 61 (19 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 166 to 188 (23 residues), see Phobius details PF02508: Rnf-Nqr" amino acids 4 to 185 (182 residues), 230.4 bits, see alignment E=7.1e-73 TIGR01948: electron transport complex, RnfABCDGE type, E subunit" amino acids 5 to 193 (189 residues), 272.4 bits, see alignment E=9.9e-86

Best Hits

Swiss-Prot: 60% identical to RNFE_ACEWD: Na(+)-translocating ferredoxin:NAD(+) oxidoreductase complex subunit E (rnfE) from Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1)

KEGG orthology group: K03613, electron transport complex protein RnfE (inferred from 100% identity to bth:BT_0621)

MetaCyc: 60% identical to Rnf complex RnfE subunit (Acetobacterium woodii)
TRANS-RXN-276 [EC: 7.2.1.2]

Predicted SEED Role

"Electron transport complex protein RnfE" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AA44 at UniProt or InterPro

Protein Sequence (194 amino acids)

>BT0621 Na+-transporting NADH:ubiquinone oxidoreductase, Electron transport complex protein rnfE (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNNFKVMMNGIIKENPIFVLLLGMCPTLGTTSSAINGMGMGLATMFVLICSNVVISSIKN
LIPDMVRIPSFIVVIASFVTLLQMIMQAYVPDLYATLGLFIPLIVVNCIVLGRAEAFAAK
NNPLASMFDGIGMGFGFTIALTLLGAVREFLGTGKIFNLTILPEEYGMLIFVLAPGAFIA
LGYLIAIINSLKKA