Protein Info for BT0618 in Bacteroides thetaiotaomicron VPI-5482

Annotation: Na+-transporting NADH:ubiquinone oxidoreductase, Electron transport complex protein rnfC (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 TIGR01945: electron transport complex, RnfABCDGE type, C subunit" amino acids 4 to 434 (431 residues), 568.8 bits, see alignment E=3e-175 PF13375: RnfC_N" amino acids 7 to 102 (96 residues), 97.2 bits, see alignment E=2.4e-31 PF01512: Complex1_51K" amino acids 130 to 276 (147 residues), 169 bits, see alignment E=3.1e-53 PF10531: SLBB" amino acids 288 to 335 (48 residues), 46 bits, see alignment 1.7e-15 PF13237: Fer4_10" amino acids 364 to 418 (55 residues), 29.9 bits, see alignment 1.9e-10 PF12838: Fer4_7" amino acids 367 to 420 (54 residues), 29.5 bits, see alignment 3.9e-10

Best Hits

KEGG orthology group: K03615, electron transport complex protein RnfC (inferred from 100% identity to bth:BT_0618)

Predicted SEED Role

"Electron transport complex protein RnfC" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AA47 at UniProt or InterPro

Protein Sequence (445 amino acids)

>BT0618 Na+-transporting NADH:ubiquinone oxidoreductase, Electron transport complex protein rnfC (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MLKTFSIGGVHPHENKLSAHQPIITAEVPAKAVILLGQHIGAPAKPIVAKGDMVKVGTKI
AEPAGFVSAAIHSSVSGKVAKIDTVVDASGYAKPAIFIDVEGDEWEETIDRSKTLVKECE
LSSEEIVKKIADAGIVGLGGACFPTQVKLCPPPSFKAECVIINAVECEPYLTADHQLMLE
HAEEVMVGVSILMKAVKVNKAFIGIENNKPDAIELMTKVASSYAGIEVVPLKVKYPQGGE
KQLIDAITKRQVASGALPISTGAVVQNVGTAFAVYEAVQKNKPLFERVITVTGKSVAKPS
NFLARIGTPMKQLIDACGGLPEDTGKVIGGGPMMGKALMNIEVPTAKGSSGILIMNQKEA
KRGEAQTCIRCAKCVSACPMGLEPYLLGALSENGDFETMEKERIMDCIECGSCQFTCPAN
RPLLDYCRLGKGKVGAMIRARQAKK