Protein Info for BT0617 in Bacteroides thetaiotaomicron VPI-5482

Annotation: Na+-transporting NADH:ubiquinone oxidoreductase, Electron transport complex protein rnfB (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR01944: electron transport complex, RnfABCDGE type, B subunit" amino acids 1 to 96 (96 residues), 72.5 bits, see alignment E=1.7e-24 PF04060: FeS" amino acids 44 to 66 (23 residues), 33.4 bits, see alignment (E = 2.1e-11) PF12800: Fer4_4" amino acids 141 to 154 (14 residues), 11.9 bits, see alignment (E = 0.00019) amino acids 171 to 185 (15 residues), 17.2 bits, see alignment (E = 3.7e-06) amino acids 220 to 233 (14 residues), 17.7 bits, see alignment (E = 2.6e-06) amino acids 247 to 262 (16 residues), 14.5 bits, see alignment (E = 2.8e-05) PF12838: Fer4_7" amino acids 142 to 186 (45 residues), 40 bits, see alignment 3.2e-13 amino acids 220 to 263 (44 residues), 39.2 bits, see alignment 5.4e-13 PF13237: Fer4_10" amino acids 142 to 184 (43 residues), 28.8 bits, see alignment 6.5e-10 amino acids 167 to 232 (66 residues), 24.6 bits, see alignment E=1.3e-08 amino acids 220 to 261 (42 residues), 33.3 bits, see alignment 2.7e-11 PF13187: Fer4_9" amino acids 142 to 187 (46 residues), 35.6 bits, see alignment 5.3e-12 amino acids 221 to 264 (44 residues), 35.7 bits, see alignment 5.2e-12 PF14697: Fer4_21" amino acids 142 to 188 (47 residues), 35.6 bits, see alignment 5.7e-12 amino acids 220 to 266 (47 residues), 35.3 bits, see alignment 7.3e-12 PF00037: Fer4" amino acids 166 to 189 (24 residues), 28.4 bits, see alignment (E = 7.4e-10) amino acids 221 to 237 (17 residues), 26.4 bits, see alignment (E = 3.1e-09) amino acids 244 to 265 (22 residues), 28.9 bits, see alignment (E = 5.1e-10) PF12797: Fer4_2" amino acids 166 to 184 (19 residues), 26.5 bits, see alignment (E = 3.1e-09) PF12837: Fer4_6" amino acids 166 to 187 (22 residues), 27 bits, see alignment (E = 2.2e-09) amino acids 220 to 236 (17 residues), 24.2 bits, see alignment (E = 1.7e-08) amino acids 243 to 261 (19 residues), 25 bits, see alignment (E = 9.5e-09) PF13534: Fer4_17" amino acids 172 to 232 (61 residues), 24.9 bits, see alignment E=1.7e-08

Best Hits

Swiss-Prot: 42% identical to RNFB_CLOLD: Proton-translocating ferredoxin:NAD(+) oxidoreductase complex subunit B (rnfB) from Clostridium ljungdahlii (strain ATCC 55383 / DSM 13528 / PETC)

KEGG orthology group: None (inferred from 100% identity to bth:BT_0617)

Predicted SEED Role

"Electron transport complex protein RnfB" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AA48 at UniProt or InterPro

Protein Sequence (293 amino acids)

>BT0617 Na+-transporting NADH:ubiquinone oxidoreductase, Electron transport complex protein rnfB (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNLILIAVISLGAIALVLAAILYVASKKFAVYEDPRIAQVGEVLPQANCGGCGYPGCSGF
ADACVKAGSLDGKFCPVGGQPVMAQIADILGLAATEAEPMVAVVRCNGSCANRPRINQYD
GAKSCAIAASLYGGETGCSYGCLGCGDCVAACQFDAIHMNPETGLPEVDEAKCTACGACV
KACPKAIIEIRPQGKKSRRVYISCVNKDKGAVARKACTVSCIGCGKCVKTCPFEAITLEN
NLAYIDPNKCKSCRKCVEVCPQNTIIELNFPPRKPKAEEAPKTVAAEAPKVTE