Protein Info for BT0610 in Bacteroides thetaiotaomicron VPI-5482

Annotation: lipopolysaccharide biosynthesis protein, putative glycosyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 83 to 102 (20 residues), see Phobius details PF00534: Glycos_transf_1" amino acids 207 to 369 (163 residues), 46.2 bits, see alignment E=5.6e-16 PF13692: Glyco_trans_1_4" amino acids 230 to 356 (127 residues), 38.8 bits, see alignment E=1.8e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_0610)

Predicted SEED Role

"Probable glycosyl transferase (EC 2.4.-.-)" (EC 2.4.-.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AA55 at UniProt or InterPro

Protein Sequence (396 amino acids)

>BT0610 lipopolysaccharide biosynthesis protein, putative glycosyltransferase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKIALLTQYYKPEMGAPQNRLYEMIHGLKECGNEVCIITGMPNYPMGKIFDDYRGKITCT
DQIDGVEIKRYWLYASNTKKVIPRIWNMVSFSFMVLFSLRYLKSKQLDYLIVESPPLTLG
LVGKWLAKHAHCKFIANISDIWPLSAKELGAISEGKLYHILENLEHRIYKGAYISMGQSQ
EIVDHIASHGGNKTYLFRNGVDPTRFADIKVHKINDGKVRLVYAGLLGFAQGVADICKSI
NFAEMGMEFHIYGSGGEQKEIEAFIASHPNNGIIYHGVVAREELPFRLKEADMTLIPLVK
NIYGAVPSKIYDSMAAALPIMFVGEGEGARIVKDNNIGLVAHSKDYEGLKDNIKYAVSHP
EEMKVMAKNCVDCAENKFNRPKQILCLNDYLKDNLK