Protein Info for BT0605 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative polysaccharide export protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 45 to 67 (23 residues), see Phobius details amino acids 85 to 109 (25 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 294 to 318 (25 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details amino acids 360 to 376 (17 residues), see Phobius details amino acids 382 to 402 (21 residues), see Phobius details amino acids 414 to 435 (22 residues), see Phobius details amino acids 441 to 465 (25 residues), see Phobius details PF01943: Polysacc_synt" amino acids 10 to 276 (267 residues), 102.1 bits, see alignment E=3.8e-33 PF13440: Polysacc_synt_3" amino acids 35 to 326 (292 residues), 210 bits, see alignment E=4.9e-66

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_0605)

Predicted SEED Role

"putative polysaccharide export protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AA60 at UniProt or InterPro

Protein Sequence (481 amino acids)

>BT0605 putative polysaccharide export protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MGKSLKSVFLSGTMWTAAENVIFTVLGIVQLAITSRILSSTDFGVYAIAVFFTGLGTIAF
SMGLGPALVQKKGDIKDYLDTAWSANLLASIVATIVLEFLIFPICTYYYHNEEGVLPSMV
IMLSVIFSAGQNPAIAYFQKEIKLKKYFYLKVFPKILSFVLVVVSVYYMKSYWGLIIALL
SEYLFRLIYSFFVYPYKVKFVIDKDKFYELYRFGGWLQLKNITSWFTTNIDVAIVGNVLG
TASLGLYNRAQTIAGYPRTFVTGVIDNVAFPLYAQITDDKSRVDHVLSQIQNIVMYLLSM
MCIVVVLYAKPIVLLVLGSTWVEMVEPFKIIFVSYVFQTLLFSFNPLLRAYGFTKQEFRF
YTIKMLVMIGLLYPLTYWYGLIGAGISILLAVICVFPYLFYTIKKLTHVELRQIFYSFGI
SLFVSFITVGVFMYIPDFDGFWWVLEMFIAITFASFFYFLLALILKKGPGLAILSLTHLK
K