Protein Info for BT0600 in Bacteroides thetaiotaomicron VPI-5482

Annotation: nucleotide sugar epimerase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01370: Epimerase
  • amino acids 13 to 269 (257 residues), 186.2 bits, E=2.1e-58
• PF04321: RmlD_sub_bind
  • amino acids 13 to 279 (267 residues), 63 bits, E=7.7e-21
• PF02719: Polysacc_synt_2
  • amino acids 13 to 183 (171 residues), 59.8 bits, E=7.7e-20
• PF01073: 3Beta_HSD
  • amino acids 14 to 287 (274 residues), 77.8 bits, E=2.2e-25
• PF16363: GDP_Man_Dehyd
  • amino acids 14 to 340 (327 residues), 174.8 bits, E=1e-54
• PF07993: NAD_binding_4
  • amino acids 15 to 213 (199 residues), 29.7 bits, E=1.1e-10

Best Hits

KEGG orthology group: K01795, [EC: 5.1.3.-] (inferred from 100% identity to bth:BT_0600)

MetaCyc: 67% identical to UDP-glucuronate 4-epimerase (Streptococcus pneumoniae)
UDP-glucuronate 4-epimerase. [EC: 5.1.3.6]

Predicted SEED Role

"UDP-glucuronate 5'-epimerase (EC 5.1.3.12)" (EC 5.1.3.12)

MetaCyc Pathways

• UDP-α-D-galacturonate biosynthesis I (from UDP-D-glucuronate) (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-sugars interconversion (4/9 steps found)
• L-ascorbate biosynthesis V (euglena, D-galacturonate pathway) (2/7 steps found)

KEGG Metabolic Maps

• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.-, 5.1.3.12

Use Curated BLAST to search for 5.1.3.- or 5.1.3.12 or 5.1.3.6

Sequence Analysis Tools

See Q8AA65 at UniProt or InterPro

Protein Sequence (354 amino acids)

>BT0600 nucleotide sugar epimerase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MVTYNVSLENKVVLVTGAAGFIGANLVKRLLNEFDSVKVIGIDSITEYYDVRLKYERLQE
LSAYGDRFVFIKDSIAKKEIVESIFTNYHPQVVVNLAAQAGVRYSITNPDAYIESNLIGF
YNILESCRHHSVEHLVYASSSSVYGSNKKVPYSTDDKVDNPVSLYAATKKSNELMAHAYS
KLYNIPSTGLRFFTVYGPCGRPDMAYFGFTNKLREGKTIQIFNYGNCKRDFTYVDDIVEG
IVCIMQHAPEKKNGEDGLPIPPYKVYNIGNNSPENLLDFVTILQEELIAAKVLPDDYDFE
THKELVPMQPGDVSVTYADTTSLEQDFGFKPSISLRKGLRAFAQWYSKYYKCEE