Protein Info for BT0600 in Bacteroides thetaiotaomicron VPI-5482

Annotation: nucleotide sugar epimerase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 PF02719: Polysacc_synt_2" amino acids 13 to 183 (171 residues), 59.8 bits, see alignment E=7.7e-20 PF01370: Epimerase" amino acids 13 to 269 (257 residues), 186.2 bits, see alignment E=2.1e-58 PF04321: RmlD_sub_bind" amino acids 13 to 279 (267 residues), 63 bits, see alignment E=7.7e-21 PF16363: GDP_Man_Dehyd" amino acids 14 to 340 (327 residues), 174.8 bits, see alignment E=1e-54 PF01073: 3Beta_HSD" amino acids 14 to 287 (274 residues), 77.8 bits, see alignment E=2.2e-25 PF07993: NAD_binding_4" amino acids 15 to 213 (199 residues), 29.7 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: K01795, [EC: 5.1.3.-] (inferred from 100% identity to bth:BT_0600)

MetaCyc: 67% identical to UDP-glucuronate 4-epimerase (Streptococcus pneumoniae)
UDP-glucuronate 4-epimerase. [EC: 5.1.3.6]

Predicted SEED Role

"UDP-glucuronate 5'-epimerase (EC 5.1.3.12)" (EC 5.1.3.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.-, 5.1.3.12

Use Curated BLAST to search for 5.1.3.- or 5.1.3.12 or 5.1.3.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AA65 at UniProt or InterPro

Protein Sequence (354 amino acids)

>BT0600 nucleotide sugar epimerase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MVTYNVSLENKVVLVTGAAGFIGANLVKRLLNEFDSVKVIGIDSITEYYDVRLKYERLQE
LSAYGDRFVFIKDSIAKKEIVESIFTNYHPQVVVNLAAQAGVRYSITNPDAYIESNLIGF
YNILESCRHHSVEHLVYASSSSVYGSNKKVPYSTDDKVDNPVSLYAATKKSNELMAHAYS
KLYNIPSTGLRFFTVYGPCGRPDMAYFGFTNKLREGKTIQIFNYGNCKRDFTYVDDIVEG
IVCIMQHAPEKKNGEDGLPIPPYKVYNIGNNSPENLLDFVTILQEELIAAKVLPDDYDFE
THKELVPMQPGDVSVTYADTTSLEQDFGFKPSISLRKGLRAFAQWYSKYYKCEE