Protein Info for BT0587 in Bacteroides thetaiotaomicron VPI-5482

Annotation: prolyl oligopeptidase family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 699 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF07676: PD40" amino acids 57 to 70 (14 residues), 11.5 bits, see alignment (E = 8.6e-05) amino acids 96 to 130 (35 residues), 12.8 bits, see alignment (E = 3.5e-05) amino acids 139 to 168 (30 residues), 22.8 bits, see alignment (E = 2.5e-08) amino acids 287 to 310 (24 residues), 20.2 bits, see alignment (E = 1.6e-07) PF00756: Esterase" amino acids 447 to 655 (209 residues), 23.8 bits, see alignment E=1.2e-08 PF00326: Peptidase_S9" amino acids 483 to 695 (213 residues), 194.7 bits, see alignment E=5.2e-61 PF01738: DLH" amino acids 526 to 673 (148 residues), 27.9 bits, see alignment E=5.7e-10

Best Hits

Swiss-Prot: 58% identical to DPP5_PORG3: Dipeptidyl-peptidase 5 (dpp5) from Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)

KEGG orthology group: None (inferred from 100% identity to bth:BT_0587)

Predicted SEED Role

"Prolyl oligopeptidase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AA78 at UniProt or InterPro

Protein Sequence (699 amino acids)

>BT0587 prolyl oligopeptidase family protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MRQANLFMMSAAMLLAACGGTKDAGKTDQVLIEKSDIKIEGKRMTPEALWAMGRIGGLAV
SPDGKKIAYTVAYYSVPENKSNREVFVMNADGSDNRQITRTPYQENEVTWIKGGSKLAFL
SNDNGSSQLYEMNPDGSGRKQLTNYDGDIEGYSISPDGKKLLFISQVKTKESTADKYPDL
PKATGIIVTDLMYKHWDEWVTTAPHPFVADFDGNGISNIVDILEGEPYESPMKPWGGIEQ
LAWNTTSDKVAYTCRKKTGLEYAVSTNSDIYVYDLNTKKTDNITEENKGYDTNPQYSPDG
KYIAWQSMERDGYEADLNRLFIMNLETGEKRFVSKAFESNVDAFVWGNDAKTIYFTGVWH
GETQIYSLDLTNDSVKAITSGMYDYEGVALFGDKLIAKRHSMSMGDEIYAVALDGSATQL
TQENKEIYDQLEMGKVEGRWMKTTDGKDMLTWVIYPPQFDPNKKYPTLLFCEGGPQSPVS
QFWSYRWNFQIMAANDYIIVAPNRRGLPGFGVEWNEQISGDYGGQCMKDYFTAIDEMAKE
SYVDKDRLGCVGASFGGFSVYWLAGHHDKRFKAFIAHDGIFNMEMQYLETEEKWFANWDM
GGAYWEKQNPIAQRTFANSPHLFVEKWDTPILCIHGEKDFRILANQAMAAFDAAVMRGVP
AELLIYPDENHWVLKPQNGVLWQRTFFEWLDKWLKAPAK