Protein Info for BT0583 in Bacteroides thetaiotaomicron VPI-5482

Annotation: hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 145 to 169 (25 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 250 to 275 (26 residues), see Phobius details amino acids 292 to 315 (24 residues), see Phobius details amino acids 334 to 355 (22 residues), see Phobius details PF04024: PspC" amino acids 114 to 172 (59 residues), 74.3 bits, see alignment E=5.5e-25 PF22571: LiaI-LiaF-TM_PspC" amino acids 206 to 353 (148 residues), 73.7 bits, see alignment E=1.3e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_0583)

Predicted SEED Role

"Glutamate synthase [NADPH] large chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AA82 at UniProt or InterPro

Protein Sequence (364 amino acids)

>BT0583 hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKKTLTVNLGGTVYHIDDDAYRLLDDYLSNLKHFFRKQEGAEEIVNDIEIRIAELFAEKV
SAGKQVITIADVEEIIARVGKPEDFGVSDDESEPHKKEQTASSGQGYTRTTTARRLFRDP
DNKLLGGVASGLAAYFDWDITLVRILMIVLLFVPYCPMIILYIIGWIIIPEARTAAEKLS
MRGEAVTIENIGKTVTDGFERVADGVNNFVNSDKPRTFLQKVGDVFVTIAAIILKIFLVA
LVIICCPVLFVLAVVIVALVFAVIAALVGGGALLYEMLPAIDWTPIATISPVMTLLGTIS
GIALIAIPLGAFLYTIMRQLFHWSPMGTGLKWSLFILWVLGLVIVIINLSALGWQLPLYG
LHCF