Protein Info for BT0571 in Bacteroides thetaiotaomicron VPI-5482

Annotation: phenylacetate-coenzyme A ligase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 PF00501: AMP-binding" amino acids 82 to 284 (203 residues), 49.4 bits, see alignment E=3.1e-17 PF14535: AMP-binding_C_2" amino acids 334 to 430 (97 residues), 109.6 bits, see alignment E=7.3e-36

Best Hits

Swiss-Prot: 50% identical to PAAK_THET2: Phenylacetate-coenzyme A ligase (TT_C0602) from Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039)

KEGG orthology group: K01912, phenylacetate-CoA ligase [EC: 6.2.1.30] (inferred from 100% identity to bth:BT_0571)

Predicted SEED Role

"Phenylacetate-coenzyme A ligase (EC 6.2.1.30)" in subsystem Aromatic amino acid interconversions with aryl acids (EC 6.2.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.30

Use Curated BLAST to search for 6.2.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AA94 at UniProt or InterPro

Protein Sequence (432 amino acids)

>BT0571 phenylacetate-coenzyme A ligase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MIWNETIECMDRESLRKIQSIRLKKIVDYVYHNTPFYRKKMQEMGITPDDINTIDDIVKL
PFTTKHDLRDNYPFGLCAVPMSQIVRIHASSGTTGKPTVVGYTRKDLSSWAECISRAFTA
YGAGRSDIFQVSYGYGLFTGGLGAHAGAENIGASVIPMSSGNTEKQITLMHDFGSTVLCC
TPSYALYLADAIKDSGYPREEFQLKVGALGAEPWTENMRHEIEEKLGIKAYDIYGLSEIA
GPGVGYECECQHGTHLNEDHYFPEIIDPNTLQPVEPGQTGELVFTHLTKEGMPLLRYRTR
DLTALHYDKCSCGRTLVRMDRILGRSDDMLIIRGVNVFPTQIESVILEMEEFEPHYLLIV
GRENNTDTMELQVEVRPDFYSDEINRMLALKKKLASRLQSVLGLGVNVKLVEPRSIERSV
GKAKRVIDNRKI