Protein Info for BT0544 in Bacteroides thetaiotaomicron VPI-5482

Annotation: ammonium transporter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 81 to 100 (20 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 278 to 295 (18 residues), see Phobius details amino acids 312 to 333 (22 residues), see Phobius details amino acids 343 to 360 (18 residues), see Phobius details amino acids 365 to 365 (1 residues), see Phobius details amino acids 367 to 387 (21 residues), see Phobius details amino acids 399 to 418 (20 residues), see Phobius details amino acids 431 to 454 (24 residues), see Phobius details TIGR00836: ammonium transporter" amino acids 79 to 484 (406 residues), 436.2 bits, see alignment E=5.9e-135 PF00909: Ammonium_transp" amino acids 81 to 484 (404 residues), 424.3 bits, see alignment E=2.1e-131

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_0544)

Predicted SEED Role

"Ammonium transporter family" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AAC1 at UniProt or InterPro

Protein Sequence (485 amino acids)

>BT0544 ammonium transporter (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MDKTYKRHSFTKLWIATAMFIFCCFATSAFAQEAVDADTFMTTTETITEVKTTPEIAETA
TASAETTPDTIGELALGLNTVWMLLAAMLVFFMQPGFALVEAGFTRVKNTANILMKNFVD
FMFGSLLYWFIGFGLMFGAGGLIGMPHFFDLSFLDSDLPREGFLVFQTVFCATAATIVSG
AMAERTKFSMYLVYTIFISVLIYPISGHWTWGGGWLMNGEEGSFMMNLFGTTFHDFAGST
IVHSVGGWIALVGAAILGPRIGKYGKDGKSRAIPGHNLTVAALGVFILWFGWFGFNPGSQ
LAASTEADAMAISHVFLTTNLAACAGGFFALAMSWMKYGKPSLSLTLNGVLAGLVGITAG
CDAVAPSGAVLIGAICGVVMIFAVDFIDKVLKIDDPVGASSVHGVCGFLGTVLTGLFSTS
EGLFYGHGAGFLGAQLFGAVVVGVWAAGMGFIIFKVLDKIHGLRVPARVEEEGLDIYEHG
ESAYN