Protein Info for BT0509 in Bacteroides thetaiotaomicron VPI-5482

Annotation: ABC transporter ATP-binding/transmembrane protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 576 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 59 to 76 (18 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 242 to 290 (49 residues), see Phobius details PF00664: ABC_membrane" amino acids 42 to 285 (244 residues), 74.2 bits, see alignment E=2.2e-24 PF00005: ABC_tran" amino acids 349 to 498 (150 residues), 112.3 bits, see alignment E=4.2e-36

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to bth:BT_0509)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AAF6 at UniProt or InterPro

Protein Sequence (576 amino acids)

>BT0509 ABC transporter ATP-binding/transmembrane protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNAIKNITVGHTERLRKPVGYTMLANLVNIVPFCLSIEAINVIFRTFDGSGTPLDTNRLW
MIFAILVVYMVVMAFAERAAYRANFRGAYEMSAEGRINLAEHLRKLSLGFLSRRDPGDLS
SMLITDFTMAETGISHHLPQLMGALVMPVFAFLGLLWIDWRMAVAMFVALPLAVAVLLLS
NIAQRKLSVRQIEAKINAGNRLEEYLQGIRVMKAYNLLGGKFERLKMAFSDLRRACIRQE
ALLGPFILFSVTLIRAGLTFMILCGTYLLIGGELSLLTFVMFLVVGSRVFDPLTSALTNF
AEFRYFSIAGGRILTLMNEPEMKGDRDVPESGDITFDHVSFGYQEKEILHDISVTLRKGT
LTALVGPSGSGKSTMLKLCARFYDPRKGSVRFNGMDMKELEPESLMKHCSMVFQDVYLFQ
DTLKNNIRFGRTDATDEEIVAAAKKACCHEFIMRLPKGYDTMVGEGGCTLSGGEKQRISI
ARAMLKEAPVVLLDEATASLDPENEVEVQQAINTLIAGRTVIVIAHRLKTIRNADRIIVL
EEGRIAEQGTHDELLSRPGLYAKLWNIQEQTSGWKL