Protein Info for BT0508 in Bacteroides thetaiotaomicron VPI-5482

Annotation: ABC transporter ATP-binding protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 609 transmembrane" amino acids 26 to 48 (23 residues), see Phobius details amino acids 74 to 101 (28 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 261 to 283 (23 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 30 to 302 (273 residues), 72.1 bits, see alignment E=6.6e-24 PF00005: ABC_tran" amino acids 374 to 523 (150 residues), 100.5 bits, see alignment E=1.3e-32

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to bth:BT_0508)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AAF7 at UniProt or InterPro

Protein Sequence (609 amino acids)

>BT0508 ABC transporter ATP-binding protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKRLKEKQRKKSGVSRLFEIAGEKKGLLMLAGVLSAISALCMLVPYWSVYEVLKELLLHG
SKISELDSSVLIHWGWVAFVGLVAGLLLLYGALMASHVAAFRILYGLRIRLSGHIGRLSL
GYLNGTSTGAIKKTMEQNVEKIENFVAHTIPDLVNVLATIVLMFIIFFSLNGWMAAICVV
CIVCSIGLQFMNFFGKKAKEFTKIYYDTQERMSASAVQYVRGMPVVKIFGQSVRSFRQFN
SEIEAYKSYALRVCDTYQPGMIAFTVLLNSLITFILPVGLLLLSRETQNIGLAAVYLFFI
IMGPGVVSPIYKLMYLGSSTNEIDEGVKRIDRIFDEQVLPETAVSHLPASYDIEFRHVSF
AYENKAETTRTEALKDISFTAPQGAITALVGPSGSGKSTVANLIPRFWDVSEGEICIGGI
NIKEIATEDLMNLVSFVFQDSFLFFDTLYENIRVGNTSATREQVIEAARAAQCHDFIESL
PDGYHTRIGDKGVYLSGGESQRVCVARAILKNAPILVLDEATAFADPENEYKMQQAIQQL
IKNKTVIIIAHRLSSIISAEQILVLKEGKLVQSGRHEVLSKTDGVYKRMWDAYTSAFRWQ
LTIKKEETK