Protein Info for BT0500 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative transport protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 532 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 52 (22 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 356 to 375 (20 residues), see Phobius details amino acids 382 to 401 (20 residues), see Phobius details amino acids 421 to 440 (20 residues), see Phobius details amino acids 447 to 469 (23 residues), see Phobius details amino acids 478 to 496 (19 residues), see Phobius details amino acids 507 to 529 (23 residues), see Phobius details PF06826: Asp-Al_Ex" amino acids 13 to 165 (153 residues), 145.8 bits, see alignment E=1.1e-46 amino acids 359 to 528 (170 residues), 162.2 bits, see alignment E=1e-51 TIGR01625: AspT/YidE/YbjL antiporter duplication domain" amino acids 18 to 152 (135 residues), 88.7 bits, see alignment E=1.7e-29 amino acids 363 to 515 (153 residues), 118.6 bits, see alignment E=1e-38 PF02080: TrkA_C" amino acids 196 to 260 (65 residues), 35.4 bits, see alignment E=8e-13 amino acids 284 to 345 (62 residues), 47.7 bits, see alignment E=1.1e-16

Best Hits

Swiss-Prot: 100% identical to Y500_BACTN: Uncharacterized transporter BT_0500 (BT_0500) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K07085, putative transport protein (inferred from 100% identity to bth:BT_0500)

Predicted SEED Role

"Predicted cobalt transporter in Bacteroides_Porphyromonas" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AAG5 at UniProt or InterPro

Protein Sequence (532 amino acids)

>BT0500 putative transport protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MFTDLLHSSYFSLFLIVALGFMLGRIKIKGLSLDVSAVIFIALLFGHFGVIIPKELGNFG
LVLFIFTIGIQAGPGFFDSFRSKGKTLILITMLIICSACLTAVGLKYAFDIDTPSVVGLI
AGALTSTPGLAVAIDSTHSPLASIAYGIAYPFGVIGVILFVKLLPKIMRVNLDQEARRLE
IERRGQFPELGTCIYRVTNASVFNRSLMQINARAMTGAVISRLKHKDEISIPTAHTVLHE
GDYIQAVGSEESLNQLSVLIGEREEGELPLDKTQEIESLLLTKKDMINKQLGDLNLQKNF
GCTVTRVRRSGIDLSPSPDLALKFGDKLMVVGEKEGIKGVARLLGNNAKKLSDTDFFPIA
MGIVLGVLFGKLNISFSDTLSFSPGLTGGVLMVALVLSAVGKTGPIIWSMSGPANQLLRQ
LGLLLFLAEVGTSAGKNLVATFQESGLLMFGVGAAITVVPMLVAVIVGRLVFKINILDLL
GTITGGMTSTPGLAAADSMVDSNIPSVAYATVYPIAMVFLILFIQVISSAVY