Protein Info for BT0499 in Bacteroides thetaiotaomicron VPI-5482

Annotation: cation efflux system protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 18 to 40 (23 residues), see Phobius details amino acids 49 to 66 (18 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 153 to 178 (26 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 17 to 288 (272 residues), 254.5 bits, see alignment E=6.2e-80 PF01545: Cation_efflux" amino acids 20 to 207 (188 residues), 133.1 bits, see alignment E=5.6e-43

Best Hits

Swiss-Prot: 36% identical to CZCD_BACSU: Cadmium, cobalt and zinc/H(+)-K(+) antiporter (czcD) from Bacillus subtilis (strain 168)

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 100% identity to bth:BT_0499)

MetaCyc: 35% identical to Zn2+/Cd2+/Ni2+/Cu2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-200

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AAG6 at UniProt or InterPro

Protein Sequence (299 amino acids)

>BT0499 cation efflux system protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MEPHHHEHNHRVTSLNKAFIIGIVLNISFVIVEFGVGFYYDSLGLLSDAGHNLGDVASLI
LAMLAFRLEKVHPNSRYTYGYKKSTILVSLLNAVILLVAVGIIIAESIDKLFHPVSVDGS
AIAWTAGVGVVVNALTAWLFMKDKDKDLNVKGAYLHMAADALVSVGVVASGIIIMYTGWS
IIDPIIGLGIAVIIIVSTWGLLHDSLRLSLDGVPVGIDTQQIQQLIVEQPGVESCHHLHI
WAISTTETALTAHVVVDDIAKMEEIKHRIKEALEAAGIHHATLEIEGEEVTCSTECCED