Protein Info for BT0469 in Bacteroides thetaiotaomicron VPI-5482

Annotation: hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 49 (20 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 101 to 124 (24 residues), see Phobius details amino acids 152 to 177 (26 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 329 to 356 (28 residues), see Phobius details amino acids 368 to 388 (21 residues), see Phobius details amino acids 394 to 412 (19 residues), see Phobius details TIGR04370: oligosaccharide repeat unit polymerase" amino acids 20 to 408 (389 residues), 116.6 bits, see alignment E=6.9e-38

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_0469)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AAJ5 at UniProt or InterPro

Protein Sequence (420 amino acids)

>BT0469 hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MSELQILIFNAAVFSILAVYHYWKNRKLNIAFYILAYYSICAWGALLYHEHELFHYMRGR
ETYSIIPFLYLIPVIFLFAYPIIRYDNTRITRIETLNSNFFINLVWILLFIQIVLYIILF
PSFLKAILSSNIGDYRNDTYDESEIVQFPNYFFNILCRLYMGARNVVILIAAYGLLVIKT
HRKLLKIFLVTSLCFPVYMFTAYASRAVMIMTFFFLVFIFVFLSVFMNVGLKKKIVSYLI
LILVPISSAFILISNSRFGNLATYMFYRYLGESFNNYNTHFFYELKGNTWGEAYFVFFRK
LMGISSNFKTTREKWEWLDNITGVDTHVFYTFVGGLNIEFGFVGTIVIGLLLSFFMVKKM
RPYNVLTLPKFIALGMLAYTLINGVFFFVLQGDWGNLEILFTLFFCFLFSKYRTRKYINK