Protein Info for BT0425 in Bacteroides thetaiotaomicron VPI-5482

Annotation: 50S ribosomal protein L20 (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01032: ribosomal protein bL20
  • amino acids 1 to 114 (114 residues), 152.1 bits, E=3.3e-49
• PF00453: Ribosomal_L20
  • amino acids 3 to 108 (106 residues), 150.2 bits, E=1e-48

Best Hits

Swiss-Prot: 100% identical to RL20_BACTN: 50S ribosomal protein L20 (rplT) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K02887, large subunit ribosomal protein L20 (inferred from 93% identity to bsa:Bacsa_1681)

MetaCyc: 56% identical to 50S ribosomal subunit protein L20 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L20p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

See Q8AAN9 at UniProt or InterPro

Protein Sequence (116 amino acids)

>BT0425 50S ribosomal protein L20 (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MPRSVNHVASKARRKKILKLTRGYFGARKNVWTVAKNTWEKGLTYAFRDRRNKKRNFRAL
WIQRINAAARLEGMSYSKLMGGLHKAGIEINRKVLADLAMNHPEAFKAVVAKAKAA