Protein Info for BT0412 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative Na+/sulfate symporter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 44 (18 residues), see Phobius details amino acids 56 to 74 (19 residues), see Phobius details amino acids 98 to 122 (25 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details amino acids 346 to 364 (19 residues), see Phobius details amino acids 375 to 404 (30 residues), see Phobius details amino acids 410 to 427 (18 residues), see Phobius details amino acids 434 to 451 (18 residues), see Phobius details amino acids 457 to 475 (19 residues), see Phobius details amino acids 495 to 515 (21 residues), see Phobius details PF03600: CitMHS" amino acids 17 to 445 (429 residues), 169.9 bits, see alignment E=1.2e-53 amino acids 346 to 513 (168 residues), 64.8 bits, see alignment E=1.2e-21 PF06808: DctM" amino acids 311 to 511 (201 residues), 29.6 bits, see alignment E=4.9e-11 PF00939: Na_sulph_symp" amino acids 348 to 516 (169 residues), 52.1 bits, see alignment E=8.5e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_0412)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AAQ2 at UniProt or InterPro

Protein Sequence (517 amino acids)

>BT0412 putative Na+/sulfate symporter (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MTFEIVFVLLSLLGMMAALIADKMRPGMVLFSVVVLFLCVGILTPKEMLEGFSNKGMITV
ALLFLVSEGIRQSGTLGQVIKKLLPQGKTTVFKAQLRILPSVAFISAFLNNTPVVVIFAP
IIKHWAKSVKLPATKFLIPLSYVTILGGICTLIGTSTNLVVHGMILEAGYEGFTMFELGK
VGIFIAIAGIIYLFIFSKRLLPDARPDTAVPDEEVEEGEKLHRVEAVLGARFPGINKKLS
DFNFQRHYGAEVKEIKTRNGQRYVDHLEDVVLREGDTLVVMADDTFIPTWGESSVFVLLT
NGNDPDTSGKKKRWLALILLVLMIVGATVGELPATKEMFPDIKLDMFFFVCITTIIMAWT
NIFPARKYTKYISWDILITIACAFAISKAMVNSGVADCVAGFIIGLSDDYGPHVLLAILF
VITNLFTELITNNAAAALAFPLALSISAQLGVSPTPFFVVICMAASASFSTPIGYQTNLI
VQGIGNYKFTDFVRIGLPLNIITFLISVILIPLIWNF