Protein Info for BT0400 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative tyrosine-protein kinase in capsular polysaccharide biosynthesis region (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 126 to 146 (21 residues), see Phobius details PF13807: GNVR" amino acids 70 to 144 (75 residues), 47.2 bits, see alignment E=4.2e-16 TIGR01007: capsular exopolysaccharide family" amino acids 196 to 402 (207 residues), 173.7 bits, see alignment E=1.8e-55 PF10609: ParA" amino acids 213 to 272 (60 residues), 30.8 bits, see alignment E=5e-11 PF13614: AAA_31" amino acids 214 to 344 (131 residues), 38.9 bits, see alignment E=2.1e-13 PF01656: CbiA" amino acids 216 to 321 (106 residues), 27 bits, see alignment E=9.8e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_0400)

Predicted SEED Role

"Tyrosine-protein kinase Wzc (EC 2.7.10.2)" in subsystem Colanic acid biosynthesis (EC 2.7.10.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.10.2

Use Curated BLAST to search for 2.7.10.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AAR4 at UniProt or InterPro

Protein Sequence (429 amino acids)

>BT0400 putative tyrosine-protein kinase in capsular polysaccharide biosynthesis region (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MLIERKRLLRTSTENNPAIVNLDTSIRAMKANVQATLEGTLQGLMITKESLDREASRYSR
RISNAPGQERAYVSIARQQEIKAGLYLMLLQKREENAIALAAPANNAKIIDEAIADDIPV
SPKRSMIYLIALMLGVGIPVGIIYLIELTKFKIEGRADVEKLTSVPVVGDIPLTDEKNDK
NGSIAVFENKNNLMSETFRNIRTNLQFMLDNDQKVILVTSTVSGEGKSFVSSNLAISLSL
LGKKVVIVGLDIRKPGLNKVFQLSNKERGITQYLSNPETDLMELVQPSDVNKNLFILPGG
TVPPNPTELLARNGLDRAIETLKKNFDYVILDTAPIGMVTDTLLIGRVADLSVYVCRADY
THKAEYTLINELSFEKKLPNLCTVINGVDLKKRKYGYYYGYGKYGKHYGYGKRYGYGYGY
GQTKSERKD