Protein Info for BT0381 in Bacteroides thetaiotaomicron VPI-5482

Annotation: capsular polysaccharide biosynthesis protein capD (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02719: Polysacc_synt_2
  • amino acids 9 to 288 (280 residues), 355.9 bits, E=5.7e-110
• PF01370: Epimerase
  • amino acids 10 to 226 (217 residues), 74.8 bits, E=2.5e-24
• PF16363: GDP_Man_Dehyd
  • amino acids 10 to 132 (123 residues), 43.3 bits, E=1.2e-14
• PF01073: 3Beta_HSD
  • amino acids 11 to 150 (140 residues), 58.1 bits, E=2.7e-19
• PF07993: NAD_binding_4
  • amino acids 11 to 144 (134 residues), 30.7 bits, E=6.4e-11
• PF13460: NAD_binding_10
  • amino acids 13 to 136 (124 residues), 30.1 bits, E=1.5e-10
• PF08485: Polysacc_syn_2C
  • amino acids 291 to 338 (48 residues), 71.6 bits, 1.2e-23

Best Hits

Swiss-Prot: 61% identical to CAPD_RICFE: UDP-glucose 4-epimerase (capD) from Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)

KEGG orthology group: None (inferred from 100% identity to bth:BT_0381)

MetaCyc: 64% identical to UDP-N-acetylglucosamine 4,6-dehydratase (configuration-inverting) (Pseudomonas aeruginosa O11)
UDP-N-acetylglucosamine 4,6-dehydratase (inverting). [EC: 4.2.1.115]

Predicted SEED Role

"UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 4.2.1.-)

MetaCyc Pathways

• UDP-N-acetyl-β-L-fucosamine biosynthesis (2/4 steps found)
• UDP-N-acetyl-β-L-quinovosamine biosynthesis (1/4 steps found)
• CMP-pseudaminate biosynthesis (1/6 steps found)
• CMP-diacetamido-8-epilegionaminic acid biosynthesis (1/7 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (7/24 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Nucleotide sugars metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Porphyrin and chlorophyll metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.- or 4.2.1.115

Sequence Analysis Tools

See Q8AAT3 at UniProt or InterPro

Protein Sequence (349 amino acids)

>BT0381 capsular polysaccharide biosynthesis protein capD (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MSIFAGKTLMITGGTGSFGNAVLNRFLRTDIGEIRIFSRDEKKQDDMRHEYQVKYPDVAH
KIKFFIGDVRNLQSCKNAMPGVDYIFHAAALKQVPSCEFFPMEAVKTNVIGTDNVLTAAI
EAGVGAVICLSTDKAAYPINAMGITKAVEEKIAVAKSRYSGKTKICCTRYGNVMCSRGSV
IPLWIEQIRNGNPVTLTEPTMTRFIMSLEEAVDLVLFAFEHGQNGDILVQKAPACTIQTQ
AEAVCELFGGKKEDIKVIGIRHGEKMYETLLTNEECAKAEDMGNFYRVPADNRGLNYDKF
FKEGETERNTLTEFNSNNTYILNVEETKVKIAALDYIQKELSGEGNFVQ