Protein Info for BT0378 in Bacteroides thetaiotaomicron VPI-5482

Annotation: capsular polysaccharide biosynthesis protein capD (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 641 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 53 to 75 (23 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 121 to 148 (28 residues), see Phobius details PF00106: adh_short" amino acids 297 to 370 (74 residues), 28.9 bits, see alignment E=2.7e-10 PF01370: Epimerase" amino acids 299 to 523 (225 residues), 75.4 bits, see alignment E=1.7e-24 PF04321: RmlD_sub_bind" amino acids 299 to 424 (126 residues), 52.4 bits, see alignment E=1.5e-17 PF02719: Polysacc_synt_2" amino acids 299 to 589 (291 residues), 397.2 bits, see alignment E=1.5e-122 PF01073: 3Beta_HSD" amino acids 300 to 428 (129 residues), 41.8 bits, see alignment E=2.5e-14 PF16363: GDP_Man_Dehyd" amino acids 300 to 423 (124 residues), 49 bits, see alignment E=2.2e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_0378)

Predicted SEED Role

"UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 4.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AAT6 at UniProt or InterPro

Protein Sequence (641 amino acids)

>BT0378 capsular polysaccharide biosynthesis protein capD (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKHAFDRFVQYLQKNYFSYWIVLGIDTFIALICTWVSFIGIHYITETSKEITSLFHILAI
SVISSILGSFLFHTYRNTIRFSQLKELWRLAGSALIKAVCIAMAIWLFLPQTGLHNSQKI
VFVLFDGMLTFIAMVGFRIQLILVYELLLNMLNKKNMHILIYGIDDKSVALKVRLMNSSH
YKVVGFCIYGTGDSIRRVADLPVYSFKDEECFNKLIHKKCIGGILFARYENTREEEDRLL
QYCKRSGLKTLIAPSISEADENGSFHQWVRPIKIEDLLGRSEIHINMEEVMTEFCGKVVL
VTGAAGSIGSELCRQLAQMNIKKLIMFDSAESPLHNVRLEFEKNYPDLDFVPVIGDVRVK
ERLRMVFETYQPQIIFHAAAYKHVPLMEENPCEAVLVNVVGSRQVADMAVEYGAEKMIMV
STDKAVNPTNVMGCSKRLAEIYVQSLGCAIREGKVKGHTKFITTRFGNVLGSNGSVIPRF
KEQIENGGPVTVTHPDIIRFFMTIPEACRLVMEAATMGEGNEIFVFEMGKAVKIVDLATR
MIELAGYRPGEDIEIEFTGLRPGEKLYEEVLSDKENTIPTENKKIMIAKVRHYEYTDILD
TYTEFEKLSRSVQIMDTVKLMKRVVPEFKSKNSPRFEVLDR