Protein Info for BT0373 in Bacteroides thetaiotaomicron VPI-5482

Annotation: mannose-6-phosphate isomerase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF20511: PMI_typeI_cat
  • amino acids 8 to 113 (106 residues), 43.9 bits, E=6.7e-15
• PF21621: MPI_cupin_dom
  • amino acids 243 to 310 (68 residues), 36.2 bits, E=1.2e-12

Best Hits

KEGG orthology group: K01809, mannose-6-phosphate isomerase [EC: 5.3.1.8] (inferred from 100% identity to bth:BT_0373)

Predicted SEED Role

"Mannose-6-phosphate isomerase (EC 5.3.1.8)" in subsystem Alginate metabolism or Mannose Metabolism (EC 5.3.1.8)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (10/11 steps found)
• GDP-mannose biosynthesis (4/4 steps found)
• β-1,4-D-mannosyl-N-acetyl-D-glucosamine degradation (3/3 steps found)
• D-mannose degradation II (2/2 steps found)
• mannitol degradation II (3/4 steps found)
• D-mannose degradation I (1/2 steps found)
• 1,5-anhydrofructose degradation (3/5 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (9/14 steps found)
• mannitol biosynthesis (1/3 steps found)
• β-(1,4)-mannan degradation (3/7 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.8

Sequence Analysis Tools

See Q8AAU1 at UniProt or InterPro

Protein Sequence (323 amino acids)

>BT0373 mannose-6-phosphate isomerase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MYPLKFEPILKQTLWGGDKIIPFKHLNSDLKGVGESWEISGVEDNESVVANGPDKGLTLA
DMVRKYREELVGEANYARFGNKFPLLIKFIDAKQDLSIQVHPADDLAKKRHNSMGKTEMW
YVVDADKGAKLRSGFSEQITPKEYKERVLNNTITDVLQEYEIKPGDVFFLPAGRVHSIGA
GAFIAEIQQTSDITYRIYDFNRKDANGKTRELHTDLAREAINYEVLDDYRTKYEAVKDEP
VELVACPYFTTSVYDMTEEISCDYSELDSFVIFICMEGACKIKDNEGNELKVGAGESILL
PATTQDVTITPEAGNVKLLETYV