Protein Info for BT0371 in Bacteroides thetaiotaomicron VPI-5482

Annotation: glucose/galactose transporter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 104 to 126 (23 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 223 to 243 (21 residues), see Phobius details amino acids 259 to 284 (26 residues), see Phobius details amino acids 297 to 320 (24 residues), see Phobius details amino acids 345 to 366 (22 residues), see Phobius details amino acids 373 to 395 (23 residues), see Phobius details amino acids 404 to 423 (20 residues), see Phobius details PF07690: MFS_1" amino acids 16 to 391 (376 residues), 52.7 bits, see alignment E=1.6e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_0371)

Predicted SEED Role

"Predicted glucose transporter in maltodextrin utilization gene cluster" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AAU3 at UniProt or InterPro

Protein Sequence (436 amino acids)

>BT0371 glucose/galactose transporter (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MTQEKKNGKIIAIITMIFLFGMISFVTNLAAPMGIVLKNQFDVSNALGMLGNFGNFIAYA
VMGIPSGILLQRVGYKKTALIAVAIGFIGVGIQFLSGHSSPEMAFAVYLIGAFVAGFSMC
LLNTVVNPMLNKLGGEGNKGNQLIQVGGSFNSVMATITPMFVGILIAGSIEKATISQIFP
VMYTAMAVFAFAFFVLLFVRIPEPNAAATTEPISTLMKGALKFRHFVLGAIAIFVYVGIE
VGVPGTLNLFLTDPVEKGGAGIASTISGFVVGTYWFLMLIGRLAGASLGAKVSSKAMLTF
TSALGLILVFLAIFSSTGTLVNLPVLQQSATGGLSFGFAEVPINAMYLVLVGLCTSIMWG
GIFNLAVEGLGKYLAAASGLFMVLVCGGGILPVIQGWVADVAGFMASYWVIIAALAYLLY
YGLVGCKNVNKDIPVE