Protein Info for BT0305 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative aminoglycoside efflux pump (Acriflavine resistance protein) (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1034 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 341 to 360 (20 residues), see Phobius details amino acids 367 to 387 (21 residues), see Phobius details amino acids 393 to 417 (25 residues), see Phobius details amino acids 438 to 460 (23 residues), see Phobius details amino acids 472 to 498 (27 residues), see Phobius details amino acids 538 to 556 (19 residues), see Phobius details amino acids 865 to 884 (20 residues), see Phobius details amino acids 891 to 912 (22 residues), see Phobius details amino acids 920 to 942 (23 residues), see Phobius details amino acids 965 to 986 (22 residues), see Phobius details amino acids 999 to 1023 (25 residues), see Phobius details PF00873: ACR_tran" amino acids 4 to 1022 (1019 residues), 1094.4 bits, see alignment E=0 TIGR00915: RND transporter, hydrophobe/amphiphile efflux-1 (HAE1) family" amino acids 4 to 1027 (1024 residues), 1169.2 bits, see alignment E=0 PF02355: SecD_SecF_C" amino acids 338 to 486 (149 residues), 27 bits, see alignment E=4.3e-10 PF03176: MMPL" amino acids 340 to 497 (158 residues), 28.8 bits, see alignment E=9.4e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_0305)

Predicted SEED Role

"RND efflux system, inner membrane transporter CmeB" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AB07 at UniProt or InterPro

Protein Sequence (1034 amino acids)

>BT0305 putative aminoglycoside efflux pump (Acriflavine resistance protein) (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKVSFFIDRPVFSAVISIVIVIVGIIGLTMLPVDQYPQITPPVVKISASYPGASALTVSQ
AVATPIEQEINGTPGMLYMESNSSNSGGFSATVTFDVSADPDLAAVEIQNRVKLAESRLP
AEVIQNGISVEKQAPSQLMTLCLTSTDPKFDEIYLSNFATINVLDVIRRIPGVGRVSNIG
SRYYAMQIWAEPDKLANFGLTVQDLQNALKDQNRESAAGVLGQQPVQGLDITIPITTQGR
LSTVGQFEDIVVRANANGSIIRLKDVARVSLEASSYNTESGINGENAAVLGIYMLPGANA
MEVAENVKKAMEEISENFPEGLSYEIPFDMTTYISESIHEVYKTLFEALVLVVLVVYLSL
QSWRATLIPVVAVPISLIGTFGFMLIFGFSINILTLLGLILAIGIVVDDAIVVVEGVEHI
METEKLSPYEATKKAMNGLSSALIATSLVLAAVFVPVSFLSGITGQLYRQFTVTIVVSVL
ISTVVALTLSPVMCSLILKPDSGKKKNIVFRKINEWLGIGSNKYVAAVTRTIKHPRRVLS
AFGMVLIAILLIHRIIPTSFLPVEDQGYFKIELELPEGATLERTRVVTERAIAYLEKNPY
IEYVQNVTGSSPRVGSNQGRAELTVILKPWEERKSTSIEKIMDTVEKHLREYPECKVYLS
TPPVIPGLGSSGGFEMQLEARGEATFDNLVDAADTLMYYASKRKELTGLSSSLQSEIPQL
YFDVDRDKVKMLGVPLADVFSTMKAYTGSVYVNDFNMFNRIYKVYIQAEAPYREHKDNIN
LFFVKASNGAMVPLTSLGNASYTTGPGSIKRFNMFTTAVIRGAAAQGYSSGQAMEIMEQI
ARDHLPDNIGLEWSGLSYQEKQAGGQTGMVMALVFLFVFLFLAAQYESWTVPIAVLLSLP
VAALGAYLGVWVCGLENDVYFQIGLVMLVGLAAKNAILIVEFAKVQVDRGEDLIQSAIYA
AKLRFRPILMTSLAFVLGMLPMVLASGPGSASRQAIGTGVFFGMIFAIVFGIILVPFFFV
MVYKTKSKILKHKK