Protein Info for BT0251 in Bacteroides thetaiotaomicron VPI-5482

Annotation: dolichol-phosphate mannosyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF00535: Glycos_transf_2" amino acids 8 to 175 (168 residues), 107.6 bits, see alignment E=3.4e-35

Best Hits

Swiss-Prot: 49% identical to PPM1_MYCS2: Polyprenol monophosphomannose synthase (ppm1) from Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

KEGG orthology group: K00721, dolichol-phosphate mannosyltransferase [EC: 2.4.1.83] (inferred from 100% identity to bth:BT_0251)

Predicted SEED Role

"Apolipoprotein N-acyltransferase (EC 2.3.1.-) / Copper homeostasis protein CutE" in subsystem Phosphate metabolism or Copper homeostasis: copper tolerance (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.4.1.83

Use Curated BLAST to search for 2.3.1.- or 2.4.1.83

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AB60 at UniProt or InterPro

Protein Sequence (247 amino acids)

>BT0251 dolichol-phosphate mannosyltransferase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MQLSDSIVIIPTYNERENIENIIRAVFGLDKVFHILVIEDGSPDGTASIVKTLQQEFPER
LFMIERKGKLGLGTAYIAGFKWALEHAYEYIFEMDADFSHNPNDLPRLYAACAKEGGDVS
VGSRYVSGVNVVNWPMGRVLMSYFASKYVRFITGIPVHDTTAGFVCYRRQVLETIDLDHV
RFKGYAFQIEMKFTAYKCGFKIIEVPVIFINRELGTSKMNSSIFGEAIFGVIKLKINSWF
HKFPQKK