Protein Info for BT0237 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 695 PF10459: Peptidase_S46" amino acids 1 to 693 (693 residues), 862.5 bits, see alignment E=4.6e-263

Best Hits

Swiss-Prot: 86% identical to DPP7_BACFN: Dipeptidyl-peptidase 7 (dpp7) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)

KEGG orthology group: None (inferred from 100% identity to bth:BT_0237)

Predicted SEED Role

"FIG00403185: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AB73 at UniProt or InterPro

Protein Sequence (695 amino acids)

>BT0237 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MWLLQLMQQQHSIDMMKKQGLKLEAQDLYNPNGVSLKDAVGIFGGGCTGEIISPEGLILT
NHHCGYSSIQQHSSVEHDYLTDGFWATSRDQELPTPGLKFTFIERIEDITDIVNAKIAAK
EITESQSFTGAFLEGLAKELYEKSDLKDKKGIVPQALPFYAGNKFYLFYKKIYPDVRMVA
APPSSVGKFGGETDNWMWPRHTGDFSMFRIYADANGEPAEYSASNTPLKTKKHLSISIKG
LKEGDYAMIMGFPGRTSRYLTVSEVKERMESTNEPRIRIRGARLAVLKEVMNASDKIRIQ
YANKYAGSSNYWKNSIGMNKAIIDNDVLGTKAEQEAKFAEYAKAQNNTEYANVVKKIDDL
VAQTAPLNYQLTCLTEVFFGAIEFGNSMLTKTREALVDKNDSLIKVRLEGLKENFKSIHN
KDYDHEVDRKVAKALLPLYAEMIPANQRPAIYKVIEQKYKGDYNKFVDDMYDKSIFANQA
NFDKFLKKPTVKAIDEDLALQYAQSKYDQYGNLLDQLKELDKELALLHKTYIRGLGEMKL
PVPSYPDANFTIRLTYGNVKPYDPKDGVHYNYYTTTKGILEKENPEDREFVVPAKLKELI
EKKDYGRYALPNGDMPVCFLSTNDITGGNSGSPVLNENGELIGCAFDGNWESLSGDINFD
NNLQRCINLDIRYVLFILEKLGNCGHLINEMTIVE