Protein Info for BT0202 in Bacteroides thetaiotaomicron VPI-5482

Updated annotation (from data): histidinol-phosphate aminotransferase (EC 2.6.1.9)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR01141.
Original annotation: histidinol-phosphate aminotransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to HIS8_BACTN: Histidinol-phosphate aminotransferase (hisC) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00817, histidinol-phosphate aminotransferase [EC: 2.6.1.9] (inferred from 100% identity to bth:BT_0202)

Predicted SEED Role

"Histidinol-phosphate aminotransferase (EC 2.6.1.9)" in subsystem Histidine Biosynthesis (EC 2.6.1.9)

MetaCyc Pathways

superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
superpathway of aromatic amino acid biosynthesis (18/18 steps found)
L-histidine biosynthesis (10/10 steps found)
superpathway of L-phenylalanine biosynthesis (10/10 steps found)
superpathway of L-tyrosine biosynthesis (10/10 steps found)
L-phenylalanine biosynthesis I (3/3 steps found)
L-tyrosine biosynthesis I (3/3 steps found)
3-(4-hydroxyphenyl)pyruvate biosynthesis (1/1 steps found)
L-tyrosine degradation II (1/2 steps found)
atromentin biosynthesis (1/2 steps found)
L-phenylalanine degradation III (2/4 steps found)
L-tyrosine degradation III (2/4 steps found)
L-phenylalanine degradation II (anaerobic) (1/3 steps found)
L-tyrosine degradation IV (to 4-methylphenol) (1/3 steps found)
4-hydroxybenzoate biosynthesis I (eukaryotes) (1/5 steps found)
L-phenylalanine degradation VI (reductive Stickland reaction) (1/5 steps found)
L-tyrosine degradation I (1/5 steps found)
L-tyrosine degradation V (reductive Stickland reaction) (1/5 steps found)
superpathway of plastoquinol biosynthesis (1/5 steps found)
superpathway of chorismate metabolism (38/59 steps found)
L-phenylalanine degradation IV (mammalian, via side chain) (2/9 steps found)
rosmarinic acid biosynthesis I (1/10 steps found)
(S)-reticuline biosynthesis I (1/11 steps found)
superpathway of rosmarinic acid biosynthesis (1/14 steps found)
anaerobic aromatic compound degradation (Thauera aromatica) (2/27 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ABA8 at UniProt or InterPro

Protein Sequence (346 amino acids)

>BT0202 histidinol-phosphate aminotransferase (EC 2.6.1.9) (Bacteroides thetaiotaomicron VPI-5482)
MKTLQELTRPNIWKLKPYSSARDEYKGAVASVFLDANENPYNLPHNRYPDPMQWELKTLL
SKIKKVSPQHIFLGNGSDEAIDLVFRAFCEPEKDNVVAIDPTYGMYQVCADVNNVEYRKV
LLDENFQFSAEKLLAATDERTKLIFLCSPNNPTGNDLLRSEIEKILREFEGLVILDEAYN
DFSEAPSFLEELDKYPNLVVFQTFSKAWGCAAIRLGMAFASEAIIGILSKIKYPYNVNQL
TQQQAIAMLHKYYEIERWIKTLKEERDYLEEEFAKLSCTVRMYPSDSNFFLAKVTDAVKI
YNYLVGEGIIVRNRHSISLCCNCLRVTVGTRVENNTLLAALKKYQG